KEGG   Ostreococcus lucimarinus: OSTLU_32279Help
Entry
OSTLU_32279       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00860  Porphyrin and chlorophyll metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_32279
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     OSTLU_32279
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     OSTLU_32279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 5002525
NCBI-ProteinID: XP_001418278
JGI: 32279
UniProt: A4RZ73
Position
6:593065..594483
Genome map
AA seq 472 aa AA seqDB search
MKKMREATVLVTEARERVGGNVTSRSDGTYTWEEGPNSYQPGDAILTLACDAGMRDDILL
ADPASNRYVLWDGKLRILPHSIESAVLGDFLTWPGKIRAGLGAIGIRPPAPGKEESVKEF
VSRNLGTEAFERLIEPFCSGVYAGDPAALSSVAATGRVQRLEPLGGSLVAGAIMAQKEAA
QNKKPRDPRLPEVKGQTVGSFRGGLKTFPEGLAKQLGDDVVKCNWKLVGVSKSAEGGYEC
AYDTPEGPQTVRTKCLLLTAPAYVAAEMVKDMAPAAATALNKFYYPPVASVTISYKKDSF
RLDGTSALPEGGLTGFGQLHPRSQGIRTLGTIYSSSLFKDDKRQPDDEFMILNYIGGARD
VAIKDLSEEELVKQVHEDALKTILKPGTPLPKVVGVKVWEKAIPQFNLGHLDVLAEAENA
LTAADCGEKDGLFLGGNYTAGVALGRCVEFGIEQADEVVAYLNAASKKAVAV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatgcgcgaggcgacggtgctcgtcacggaggcgcgcgaacgcgtcggaggg
aacgtcacgagtcgatcggatgggacgtacacgtgggaggagggaccgaactcgtatcag
ccgggggatgcgatcttgacgctggcgtgcgacgcggggatgcgcgacgacatcttgctg
gcggatccggcgagcaatcggtacgtgctgtgggacgggaagctgcggattttaccgcac
agcattgagagcgcggtgttgggggattttttgacgtggccggggaagattcgggcggga
ttgggggcgatcggaatcaggccgccggcgccgggcaaggaggagagcgtgaaggagttc
gtgagcagaaacttggggacggaggcgttcgaacgtctgatcgaaccgttttgctcgggc
gtgtacgcgggtgatcccgcggcgctgtcgtccgtggcggcgacggggcgcgtgcaacga
ctcgaaccgctcggcgggtcgctcgtcgccggcgccatcatggcgcaaaaggaggcggcg
cagaacaagaaaccgcgcgatccgcgccttcccgaggtcaagggccaaaccgtcggctcg
ttccgcggtggtttgaagacgttcccggagggtttggccaagcagctcggcgacgacgtc
gtcaagtgcaactggaagctcgtcggcgtctcgaaatccgccgagggcgggtacgagtgc
gcgtacgacaccccagaagggccgcaaacggtgagaacgaagtgtttgttgctcaccgcg
ccggcttacgtcgcggccgagatggttaaggacatggctcccgcggcggcgacggcgctg
aacaagttttactacccacccgtcgcgtcggtgacgatttcctacaagaaggattcgttc
cgcctcgacggcaccagcgcgttacccgaaggcggcctcactggcttcggtcagctccac
ccgcgctcgcaaggcattcgcacgctcggcacgatttatagctcgagcctgttcaaggac
gacaagcgtcaaccggacgacgagttcatgattttgaactacatcggcggcgcgcgcgac
gtcgcgattaaagacttgagcgaggaggagctcgtgaagcaagtccacgaggacgccttg
aagacaatcttgaagcccggtacgccgcttcccaaggttgtcggcgtcaaggtttgggaa
aaggccatcccgcaattcaacctcggccacttggacgtcctcgccgaagccgagaacgcg
ttaaccgccgccgactgcggcgaaaaagacggcttgttcctcggcggcaactacaccgcg
ggcgtcgcgttgggtcgatgcgtcgagttcggcatcgagcaagcggacgaagtcgtggcg
tacttaaacgccgcatccaagaaggccgtcgcggtgtga

DBGET integrated database retrieval system