KEGG   Ostreococcus lucimarinus: OSTLU_32331Help
Entry
OSTLU_32331       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OSTLU_32331
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OSTLU_32331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OSTLU_32331
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OSTLU_32331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 626 aa AA seqDB search
MKYVSTRGGAPPTTFVDALLTGSPLDGGAYVPERVPTIDFKKILNSSYETLCVEILSVFC
ANGEEFTKETLREIAHEACKTFADDAIAPVKTLGRRGARGWVHACELHRGPTLSAEDASM
QMAVRMMDRALKLRGKRGNVMCSTTGEEGGAFARVAAEMKNMDAWIVYPGDDGDVTEPQE
REMTCHVEDHVHPVKVSECPDGMSDVDAVVIDVLNDEAFRLANGMVSANSANVARVLCFV
PLFFHAYGQVRAKREEWGRPVVFSIPSSTFALEYAGHLARLMGLPITVVAACNANGAAHR
AISLGELYKTDMVHTSSSALDVVVAENMWRSLYYATGSNPLILSELQDDFDEDGEVELPP
KMTSELNAVFKSAVVSDELMYSTIQREERMGYLPCPQTAIAIAALELVEDIAEDVPCVAL
AVSHPSKFPTVIRRAVPQLSNGASHPTVDGMKGLFHRRRTCSLEELERSLRRDISAVTSL
RSPAPVKIERVLLARDEYEKIYMTTVIKRKRWRGFDSPLFTIACAVAVAAWAAVTTPETN
RQTGSARAAARAAAKARRAAAKASGEKARALARTQRQAARDAAKLAKIQAESARESARPR
VYARDRRAARPPNEHFAHQPHRNIYA
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtgagcacgcgcggcggcgcgccgccgacgacgttcgtcgacgccctgctc
acgggctcgccgctggacggcggcgcgtacgtcccggagcgcgtcccgacgatcgatttc
aaaaagattttaaattcgagctacgagacgctgtgcgtggaaatcctgtcggtgttttgc
gcgaatggcgaggagttcacgaaggaaacgctgcgagagatcgcgcacgaggcgtgtaag
acgttcgcggacgacgcgatcgcgccggtgaagacgctcgggcgaagaggcgcgagagga
tgggtgcacgcgtgcgaattgcatcgcggaccgacgctgagcgcggaggacgcgagcatg
cagatggcggtgcggatgatggatcgggcgttgaaactacgtgggaagcgaggaaatgtg
atgtgctcgacgacgggggaagaggggggggcgttcgcgcgcgtggcggcggagatgaag
aatatggacgcgtggatcgtgtacccgggcgacgacggcgacgtgaccgagcctcaggaa
cgagagatgacgtgtcacgtggaggatcacgtgcatccggttaaggtgagcgaatgcccg
gatggaatgagcgatgtggacgcggtcgtgatcgatgtgctgaacgatgaggcgtttcgg
ttggcgaacgggatggtgagcgcgaatagcgccaacgtggcgcgcgtgttgtgctttgtg
ccgttattttttcacgcctacggacaagtgcgcgcgaagcgcgaagagtgggggagaccc
gtggtgttcagtataccgagctccacgttcgcgctggagtacgccggtcacctggcgcgt
ttgatggggttgccgatcaccgtcgtcgccgcgtgcaacgccaacggcgcggcgcaccgc
gccatctcgctcggtgaattgtacaagactgatatggtgcacacgtcgtcgagcgcgttg
gatgtcgtcgtggctgaaaacatgtggcggtcgctgtactacgccactggatcaaatccg
ctgattttgagcgagctgcaagacgatttcgacgaagacggcgaagttgaattgccaccg
aagatgacgagtgagttaaacgccgtgttcaagagcgcggtcgtgagcgacgaactcatg
tatagcacgatacagcgcgaggagcgcatggggtacttaccctgtcctcaaactgcgatc
gcgatcgcggcgctggagttggtcgaggacatcgccgaggacgttccgtgtgtggcgctc
gcggtgtcgcatccgagcaagtttccgaccgttatccgtcgcgcggtgccgcaactgagc
aacggagcttcacatcctactgtggatggtatgaagggcttgttccaccgccgtcgcacg
tgctcgctcgaagagctcgaacgctcgttgcgcagagacatctcagcggtgacttcgctg
cgctcgcccgctccggttaagatcgagcgcgtcttactcgcgcgcgacgagtacgagaag
atttacatgaccaccgtgatcaagcgcaaacgatggcgaggtttcgacagtccactgttc
accatcgcctgcgccgtcgcggtcgccgcgtgggccgccgtcaccacgccggagacgaac
cggcaaaccgggtccgcgcgcgccgccgcgcgcgccgccgccaaagcgcgacgcgccgcc
gccaaagcgagcggcgaaaaagcgcgagcattagccaggactcagcgccaagccgcgcgc
gacgccgccaagctcgccaaaatccaagccgagtcggcgcgcgaatccgcgcgtcctcgc
gtctacgcgcgcgaccgccgcgcggcgcgtccacccaacgagcacttcgcgcaccaaccc
catagaaacatttatgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system