KEGG   Ostreococcus lucimarinus: OSTLU_32358Help
Entry
OSTLU_32358       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
olu  Ostreococcus lucimarinus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OSTLU_32358
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OSTLU_32358
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OSTLU_32358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 355 aa AA seqDB search
MSAATGRATLATGARRDARRARRATRPRASAPSGVDDGAVSIRRRPPNGPSKHDLGVGQF
EFVIEEVAPTGERVTNENNKPKNILEEIVWYKDVELAERKEKFPLQLVRTALVNAPPTRD
FVKAITDQLAATKQPGLIAEVKKASPSKGVIQPNFDPVKIAKAYEEGGAACLSVLTDEKF
FQGGFENLALIREAGVTCPLLCKEFIVDAYQIYLARKYGADAILLIAAVLPNQDLKYFIK
IAHSLGMKCLIEVHTYGEMKRVLDGDFPIDLLGINNRDLGTFEVSLSVTTDLMNGPLGEE
VKRRGITMVGESGIFTIDDVNLLQDSGVGAVLVGESLVKQDTPDVGIKKLFGRPV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcgacgggacgcgcgacgctcgcgacgggcgcgcgacgggacgcgcgacgc
gcgcgacgcgcgacgcgcccgcgcgcgagcgcgccctcgggcgtggacgacggcgcggtg
agcatccgacgacgaccgccgaacggaccgtccaagcacgacctgggcgtcggacagttt
gagttcgtgatcgaggaagtcgcgccgacgggcgagcgggtgacgaacgagaacaacaag
ccgaagaacatcttggaggagatcgtgtggtataaagacgtggaactcgcggaacgcaag
gagaaattcccgttgcagttggtgcgaacggcgctggtgaacgcgccgccgacgagggat
tttgtgaaggcgatcacggatcagttggcggcgacgaaacagccgggactgatcgcggag
gtgaagaaggcgtcgccgtcgaagggggtgattcagccgaattttgatccggtgaaaatc
gcgaaggcgtacgaggagggtggggcggcgtgtttgagcgtgttgacggatgaaaagttc
tttcagggtggatttgaaaacttggcgctcattcgcgaggctggggtgacgtgcccgttg
ctctgcaaggagttcatcgtggacgcgtatcaaatttatctcgcgcgcaagtacggcgcc
gacgcgattttgttgatcgccgcggttttgcccaaccaagatttgaagtacttcattaag
attgcgcactcgctgggcatgaagtgcttgatcgaggtgcacacgtacggggagatgaag
cgcgtgttggacggagactttcccatcgatttgctcggcatcaacaaccgggatttggga
acgtttgaggtcagcttgagcgtcaccaccgatctcatgaacgggccgctcggcgaggag
gttaagagacgcggcatcaccatggttggcgagtctggaatcttcaccatcgacgacgtc
aacttgttgcaagattccggcgtcggcgcggtcttggtcggcgagtccctcgtcaagcag
gacaccccggacgtcggcatcaagaaattgttcggccgcccggtgtga

DBGET integrated database retrieval system