KEGG   Ostreococcus lucimarinus: OSTLU_32665Help
Entry
OSTLU_32665       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
olu  Ostreococcus lucimarinus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OSTLU_32665
   00240 Pyrimidine metabolism
    OSTLU_32665
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OSTLU_32665
   03410 Base excision repair
    OSTLU_32665
   03420 Nucleotide excision repair
    OSTLU_32665
   03430 Mismatch repair
    OSTLU_32665
   03440 Homologous recombination
    OSTLU_32665
DNA repair and recombination proteins [BR:olu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      OSTLU_32665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 118 aa AA seqDB search
MPPRSARRPPSATTIDALFRSTKPGAARPGKTKGANVAIEDDDAETIDDDDAVERDAREL
KTFDLTSKFGPCCGLTRIERWDRARALGLDPPKRVLEILHRRGEASARWRECVWHGRV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcgaagcgcgcgacgaccgccctcggcgacgacgatcgacgcgctgttcagg
tcgacgaaaccgggcgcggcgagaccgggcaagacgaaaggcgcgaacgtcgcgatcgag
gacgacgacgccgagacgatcgacgacgacgacgcggtcgagcgcgacgcgcgcgagctg
aagacgtttgacttgacgtccaagtttgggccgtgctgcggattgacgcgaatcgagcga
tgggatcgcgcgcgcgcgctcggtttagacccgccgaagcgcgtgttagagattctgcat
cgtcgcggcgaggcgagcgcgcgatggagagagtgcgtgtggcacggacgggtgtga

DBGET integrated database retrieval system