KEGG   Ostreococcus lucimarinus: OSTLU_32665Help
Entry
OSTLU_32665       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00230  Purine metabolism
olu00240  Pyrimidine metabolism
olu01100  Metabolic pathways
olu03030  DNA replication
olu03410  Base excision repair
olu03420  Nucleotide excision repair
olu03430  Mismatch repair
olu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OSTLU_32665
   00240 Pyrimidine metabolism
    OSTLU_32665
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OSTLU_32665
   03410 Base excision repair
    OSTLU_32665
   03420 Nucleotide excision repair
    OSTLU_32665
   03430 Mismatch repair
    OSTLU_32665
   03440 Homologous recombination
    OSTLU_32665
DNA replication proteins [BR:olu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    OSTLU_32665
DNA repair and recombination proteins [BR:olu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      OSTLU_32665
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     OSTLU_32665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 5002724
NCBI-ProteinID: XP_001418707
JGI: 32665
UniProt: A4S099
Position
7:join(447167..447266,447345..447601)
Genome map
AA seq 118 aa AA seqDB search
MPPRSARRPPSATTIDALFRSTKPGAARPGKTKGANVAIEDDDAETIDDDDAVERDAREL
KTFDLTSKFGPCCGLTRIERWDRARALGLDPPKRVLEILHRRGEASARWRECVWHGRV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcgaagcgcgcgacgaccgccctcggcgacgacgatcgacgcgctgttcagg
tcgacgaaaccgggcgcggcgagaccgggcaagacgaaaggcgcgaacgtcgcgatcgag
gacgacgacgccgagacgatcgacgacgacgacgcggtcgagcgcgacgcgcgcgagctg
aagacgtttgacttgacgtccaagtttgggccgtgctgcggattgacgcgaatcgagcga
tgggatcgcgcgcgcgcgctcggtttagacccgccgaagcgcgtgttagagattctgcat
cgtcgcggcgaggcgagcgcgcgatggagagagtgcgtgtggcacggacgggtgtga

DBGET integrated database retrieval system