KEGG   Ostreococcus lucimarinus: OSTLU_32688Help
Entry
OSTLU_32688       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OSTLU_32688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OSTLU_32688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OSTLU_32688
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OSTLU_32688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 417 aa AA seqDB search
MTPPTQGKISEQSRPDANGRYGAYGGKYVPETLIPALRALEKEYEAIKTDPAFQAELKDI
LKDYVGRENPLYYAERLSEHFKDANGEGPDVYLKREDLNHTGAHKINNAVGQALLAKRMG
KKRIIAETGAGQHGVATATVCARFGLECIIYMGAADMERQKLNVFRMRLLGATVRPVRAG
TATLKDATSEAIRDWVTNVEDTHYILGSVAGPHPYPMMVRDFHAVIGQETRRQAMEKWGG
LPDILVACVGGGSNAMGLFHEFIDDESVRIIGVEAGGEGIEPGQKHAATLTLGTPGVLHG
SFSYLIQDEEGQIVEPHSISAGLDYPGIGPEHAFLKDFGRAEYHAITDKEALDAFVATSR
LEGIIPALETSHALAYLWKLCPGLPNGTKVVLNCSGRGDKDVNTAAKFLDISGEVDG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccgacgcaggggaagatctcggagcagtcgcgaccggacgcgaacgggagg
tacggcgcgtacggggggaagtacgtgccggagacgctgatcccggcgctgcgggcgctg
gagaaggagtacgaggcgatcaagacggacccggcgttccaggcggagctgaaggatatt
ctgaaggattacgtcggacgcgagaatccgctgtactacgccgaaaggttgagcgaacac
ttcaaggacgcgaacggggaagggccggacgtgtacctgaagcgcgaagacctgaaccac
acgggggcgcacaagatcaacaacgcggtcgggcaagcgctgttggcgaagcgaatgggg
aagaagcgcatcatcgctgagaccggggcgggacaacacggcgtggcgacggcgacggtg
tgcgcgcgattcgggttggagtgtatcatttacatgggcgcggcggatatggagcgacaa
aagctcaacgtgttccgcatgcgtttgctcggcgccacggttcgaccggtgcgcgcgggc
acggccacgctcaaggatgcgacgtctgaggctattcgtgactgggtgacgaacgttgag
gacacgcactacatcctcggctcggtcgcgggcccgcacccgtatccgatgatggtgcgc
gacttccacgccgtcatcggtcaagagactagaagacaagccatggagaaatggggcggt
ttgccggacatcctcgtcgcgtgcgttggcggtggctccaacgccatgggtctgttccac
gagttcatcgacgacgaatccgtgcgcatcatcggcgtcgaagccggcggcgaaggcatc
gagccgggccaaaagcacgccgcgacgctcaccttgggcaccccgggcgtgcttcacggc
tcgttctcgtacttgattcaagatgaagagggtcaaatcgttgagccgcactccatctcc
gccggtctcgattacccgggcatcggtccggagcacgccttcttgaaggatttcggtcgc
gccgagtaccacgccatcaccgacaaggaagcgctcgacgctttcgtcgccacctctcgt
ctcgagggtatcatccctgcccttgaaacgtcccacgccttggcgtacttgtggaagctc
tgccctggtctccccaacggcaccaaggttgtcctcaactgcagcggccgcggcgacaag
gacgtcaacaccgccgccaagtttttggacatcagcggtgaggtcgacgggtga

DBGET integrated database retrieval system