KEGG   Ostreococcus lucimarinus: OSTLU_32853Help
Entry
OSTLU_32853       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OSTLU_32853
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OSTLU_32853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 226 aa AA seqDB search
MASYPAPIVVEPRGGDANAAMILLHGLGDTGRGWAGAAGQIPTPAGAHVRWVFPTAKTMP
VTLNGGMRMTAWFDLNALDERSIVDDRGEIDASVEYLNALVREQMDKGIPSEKIMIGGFS
QGGAIALTAALRSEVKLAGCVAMSTYLPLRADYPDRFGAHAKSLKIFQAHGTSDMVLQYS
YGKMSAELMQAAGVDVDFKTYNGMAHSACAEEFDDVADFLKARLAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtacccggcgccgatcgtcgtcgaaccgcggggaggcgacgcgaacgcggcg
atgattctgttgcacggattgggcgacaccggacgcggatgggcgggcgcggcggggcag
attcccacgccagcgggcgcgcacgtgcgatgggtgtttccgacggcgaaaacgatgccg
gtgacgctgaacggagggatgcgcatgacggcgtggttcgatttgaacgcgttggacgaa
cgctccatcgtggacgacagaggcgaaatcgacgcgtcggttgaatatttgaacgcgttg
gtgcgagagcagatggataaaggaattccgagcgagaaaattatgatcggcgggttctcg
cagggcggcgcgatcgcgctgacggcggcgttgcggtcggaggtgaagctcgcggggtgc
gtggcgatgtcgacgtatcttccgttgcgcgccgattacccggacaggttcggcgcgcac
gccaagagtttgaagatttttcaagcgcacggaacgagcgacatggtgttgcaatactcg
tacggaaaaatgtccgcggaattgatgcaagcggcgggcgtcgatgttgattttaagacg
tacaacgggatggcgcacagcgcgtgcgccgaggaattcgacgacgtcgccgacttcttg
aaagccaggctggctggatga

DBGET integrated database retrieval system