KEGG   Ostreococcus lucimarinus: OSTLU_32853Help
Entry
OSTLU_32853       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OSTLU_32853
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OSTLU_32853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 DLH Abhydrolase_6 FSH1 Abhydrolase_1 Abhydrolase_5 DUF2974 Peptidase_S9 Cutinase Esterase AXE1 Lipase_3
Motif
Other DBs
NCBI-GeneID: 5002854
NCBI-ProteinID: XP_001418794
JGI: 32853
UniProt: A4S0T1
Position
7:750073..750753
Genome map
AA seq 226 aa AA seqDB search
MASYPAPIVVEPRGGDANAAMILLHGLGDTGRGWAGAAGQIPTPAGAHVRWVFPTAKTMP
VTLNGGMRMTAWFDLNALDERSIVDDRGEIDASVEYLNALVREQMDKGIPSEKIMIGGFS
QGGAIALTAALRSEVKLAGCVAMSTYLPLRADYPDRFGAHAKSLKIFQAHGTSDMVLQYS
YGKMSAELMQAAGVDVDFKTYNGMAHSACAEEFDDVADFLKARLAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtacccggcgccgatcgtcgtcgaaccgcggggaggcgacgcgaacgcggcg
atgattctgttgcacggattgggcgacaccggacgcggatgggcgggcgcggcggggcag
attcccacgccagcgggcgcgcacgtgcgatgggtgtttccgacggcgaaaacgatgccg
gtgacgctgaacggagggatgcgcatgacggcgtggttcgatttgaacgcgttggacgaa
cgctccatcgtggacgacagaggcgaaatcgacgcgtcggttgaatatttgaacgcgttg
gtgcgagagcagatggataaaggaattccgagcgagaaaattatgatcggcgggttctcg
cagggcggcgcgatcgcgctgacggcggcgttgcggtcggaggtgaagctcgcggggtgc
gtggcgatgtcgacgtatcttccgttgcgcgccgattacccggacaggttcggcgcgcac
gccaagagtttgaagatttttcaagcgcacggaacgagcgacatggtgttgcaatactcg
tacggaaaaatgtccgcggaattgatgcaagcggcgggcgtcgatgttgattttaagacg
tacaacgggatggcgcacagcgcgtgcgccgaggaattcgacgacgtcgccgacttcttg
aaagccaggctggctggatga

DBGET integrated database retrieval system