KEGG   Ostreococcus lucimarinus: OSTLU_33057Help
Entry
OSTLU_33057       CDS       T01029                                 

Gene name
HAG3501
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     OSTLU_33057 (HAG3501)
Transcription machinery [BR:olu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     OSTLU_33057 (HAG3501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 447 aa AA seqDB search
MQRGTRAREDASDQDDVSGSARGVKHARADESGANGSRDGAGAADGTPNKQTTTTGATAG
ATGATSPVSPSRGAYATRESHLRKQERDGELKWEVIKNDGSEANSRLLVALKNIFSKQLP
NMPKEYIVRLVFDSRHYSMLCMKNGNVIGGITYRPFPKQRMGEIAFCAVSANEQVKGYGT
RLMNHIKEYAKEKENMTHLITFADNNAVGYFQKQGFTKEIMMEREKWYGYIKEYDGGTIM
ECQLDGHVSYVDFVNQIREQRKAVEAKVREMSTAHKVYPGLKDHFKPSAEGKYIPIDVKH
IKGLKEAKWEDPGLPKYRLVHPGCGDGIPTKANLHKFMRAIVNVIQAHSDAWPFAAPVNP
LEVTDYYDVVKDPVDMELIQERVSAGNYYVSLEMFCADFRLMFNNCRIYNSRDTPYFKAA
NRLEAFFESKIAAGVNWKIREAPSRGR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcggcacgcgcgcgcgtgaggacgcgagcgatcaggatgatgtctcgggaagc
gcgcgcggcgtgaagcacgcgcgcgcggatgagagcggcgcgaacgggtcgagggacggc
gcgggggcggcggacggaacgccgaataaacaaacgacgacgacgggcgcgactgcgggc
gcgacgggggcgacgtcgccggtgtcgccgtcgagaggggcgtacgccacgcgagaatcg
cacctgcgtaagcaagagcgtgatggggagctgaagtgggaggtgattaaaaacgacggg
agcgaggcgaattcgcgcttgctcgtggcgctgaagaacatttttagcaaacagctgccg
aatatgcccaaggagtacatcgtgcggttggtttttgactccagacattactcgatgctg
tgcatgaagaatgggaacgtcatcggggggatcacgtacaggccgtttccgaagcaacgc
atgggtgagattgctttttgcgcggtgagcgcaaatgaacaggtgaagggatacggtacg
cggttgatgaatcacatcaaggagtacgctaaggaaaaggaaaatatgacgcacctgatc
acgttcgcggataacaatgcggtggggtactttcaaaagcaaggattcacaaaggaaatc
atgatggagcgcgaaaagtggtacgggtacatcaaagagtacgacggtgggacgattatg
gagtgtcaattagatgggcacgtctcctacgtggactttgtgaatcagatccgagaacag
cgcaaggcggtggaggccaaggtacgagagatgagcacggcgcacaaagtctacccggga
ttgaaggaccacttcaagccgagcgccgagggcaagtatatccccatcgacgtcaaacac
atcaaaggcttgaaagaggcgaagtgggaggacccaggactaccaaagtaccgtttagtc
cacccaggatgcggcgatggcatacccacgaaggcaaacttgcataaattcatgagagcc
atcgtaaacgtgattcaggcgcactccgatgcgtggccgtttgccgcacccgtgaacccg
ctcgaagtcacagactactacgacgtcgtcaaggatcccgtcgatatggaactcatccaa
gaacgcgtctcggcggggaattactacgtctctttggagatgttttgcgccgacttccgt
ttgatgttcaacaactgtcgcatatacaactcacgcgacactccgtatttcaaagcggcc
aatcgtctcgaggcgttcttcgaatcgaaaatcgccgccggggtgaattggaaaattcgc
gaggcaccttctcgaggtcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system