KEGG   Ostreococcus lucimarinus: OSTLU_33083Help
Entry
OSTLU_33083       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
olu  Ostreococcus lucimarinus
Brite
Exosome [BR:olu04147]
 Exosomal proteins
  Proteins found in most exosomes
   OSTLU_33083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 137 aa AA seqDB search
MSGWDAMIESLSVIAVPDGDAAALSACCIADHAGNVWGQSAQFPGFNADEARALMALFAD
PIERASEGITIGGSRYVFLNGGDDYGVVRGKRGAQHGVVIKKTKTAFVIGIHGDNLETRQ
VSAHVEQFGDYLASQGM
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctgggacgccatgatcgagtcgctgagcgtgatcgccgtccccgacggcgac
gccgcggcgctgagcgcgtgctgcatcgcggaccacgcgggaaacgtctggggacaaagc
gcgcaattcccaggtttcaacgccgatgaagcgcgggcgttgatggcgttattcgctgat
cccatcgagcgcgcgagcgagggcatcaccatcggtggctcgcgctacgtctttctcaac
ggcggcgacgactacggcgtcgtgcgcggcaagcgcggcgcgcagcacggcgtcgtgatc
aaaaagaccaaaacggcgttcgtgatcggcattcacggcgataacttggagacgagacaa
gtcagcgcgcacgtcgagcagttcggcgactacttggcgtctcagggcatgtaa

DBGET integrated database retrieval system