KEGG   Ostreococcus lucimarinus: OSTLU_33884Help
Entry
OSTLU_33884       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K07199  
5'-AMP-activated protein kinase, regulatory beta subunit
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 272 aa AA seqDB search
MGGRGCAFVRVRARSRRRTREGNARGARGEESPEREGAARRRAATRTRLTNARANRPQTP
TVPIPGGEGGGVNYPAWATTEPALVPVAINWTQGGNSVEVEGSFDNWQSRQTLHRSGNRE
FAIVMSLRPGVYQYKFIVDGQWKYAPDQPAMYDEIGNVNNVLEVQEYVPEILDSLDAFTA
PASPPASYDCAPFNSDDFAKEPPPLPPQLHMTLLNMPMVPDAPNLLPRPQHVVLNHTYCD
GTKSESGVQVLGTTHRYRSKYITVVFLKATQS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcgcggatgcgctttcgtacgggtgcgcgcgcgatcgcgacggcgaacgagg
gagggaaacgcgcgcggggcgcgcggggaagagagtcccgagcgcgagggcgcggcgcgg
cgacgcgcggcgacgaggacacgactgacgaacgcgcgcgcgaacagaccgcaaacgccc
acggtgccgatacccggcggggagggtggaggggtgaattacccggcgtgggcgacgacg
gaaccggcgctggtgccggtggcgataaattggacccaaggcgggaacagcgtggaggtg
gaggggagctttgataactggcagtctcggcagacgctgcatcggagcgggaacagggag
tttgcgatcgtgatgtcgctgcgaccgggggtgtatcagtacaagtttatagtggatgga
cagtggaaatacgcgccggatcaaccggcgatgtacgacgagattggcaacgtgaacaac
gtgttggaggtgcaggaatacgtgccagaaattttggatagcttggatgcgtttacggcg
ccggcgtcgccaccggcgagctacgattgcgcaccgtttaactcggacgactttgcaaag
gaaccgccaccgctaccaccgcagttgcacatgactctgttgaacatgcccatggtgccc
gacgcgccgaatttgctcccgcgaccgcaacacgtggtgctcaatcacacgtattgcgac
gggacaaagtcggagagcggagtgcaggtgctcggaacgacgcacagatatcgatcaaag
tacatcacggtcgtcttcttgaaagccacgcaatcgtag

DBGET integrated database retrieval system