KEGG   Ostreococcus lucimarinus: OSTLU_34850Help
Entry
OSTLU_34850       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00010  Glycolysis / Gluconeogenesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_34850
Enzymes [BR:olu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     OSTLU_34850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF5033
Motif
Other DBs
NCBI-GeneID: 5003514
NCBI-ProteinID: XP_001419644
JGI: 34850
UniProt: A4S333
Position
9:590783..591640
Genome map
AA seq 285 aa AA seqDB search
MTTHDALVGTLPGVRLENDTHVCEITRFGAHVASWRVKRTSDELLFRSKLAKLDGTKAIR
GGVPVCFPQFSDMGPCAQSHGFARTSVWAVEALSATEVTMVLRRGDEAGDGDAFGGDYEA
RFTATLDGDALRTALRVTNAGKSCFEFTSALHTYFRVSDCAKTKVRGLRGTTYLDNLRAR
ASAKDDEDAVEFSGEVDRIYTDAPSVLTIDDEALGRRFRVAKTSTFPDAVVWNPALTDKT
RGMSDFGDEEYREMVCVEVAGVKDKITVEPGETWEASQTISYSAI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccacgacgccctcgtcggcacgctccccggcgttcgcctcgaaaatgacacc
cacgtgtgtgaaatcactcgcttcggcgcgcacgtcgcgtcgtggcgcgtcaaacgcacg
agcgatgagcttttgtttcgctcaaagttggccaagctcgacggaacgaaagccattcgc
ggcggcgtgccggtgtgtttcccgcaattcagcgacatggggccgtgcgcgcagtcgcac
gggttcgcgcgaacgtccgtgtgggccgtggaggcgctgagcgcgacggaggtgacgatg
gtgctgcgacgcggtgacgaggcgggcgacggcgacgcgttcggcggcgactacgaggcg
cggttcacggcgacgctcgacggtgacgcgttgcgcacggcgttgcgcgtaacgaacgct
gggaagagttgtttcgagtttacgtcggcgttgcacacgtacttcagggtttcagattgc
gcgaagaccaaggtgcgcgggttgcgcgggacgacgtatttagacaatttgcgcgcgaga
gcgagcgcgaaggacgacgaagacgcggtggagttttctggcgaggtggataggatctat
accgacgcgccgagcgtgttgactatagacgatgaggctctcgggcggaggtttcgcgtt
gcaaagacgtcgacgtttccggacgccgtcgtgtggaatccggcgttgacggacaagacg
cgaggcatgagcgactttggcgacgaggaataccgcgagatggtgtgcgtcgaagtcgcc
ggagtgaaggataagatcaccgtggagccaggagagacgtgggaggcatcgcagacgatt
agctatagcgcgatttaa

DBGET integrated database retrieval system