KEGG   Ostreococcus lucimarinus: OSTLU_34850Help
Entry
OSTLU_34850       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:olu00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 285 aa AA seqDB search
MTTHDALVGTLPGVRLENDTHVCEITRFGAHVASWRVKRTSDELLFRSKLAKLDGTKAIR
GGVPVCFPQFSDMGPCAQSHGFARTSVWAVEALSATEVTMVLRRGDEAGDGDAFGGDYEA
RFTATLDGDALRTALRVTNAGKSCFEFTSALHTYFRVSDCAKTKVRGLRGTTYLDNLRAR
ASAKDDEDAVEFSGEVDRIYTDAPSVLTIDDEALGRRFRVAKTSTFPDAVVWNPALTDKT
RGMSDFGDEEYREMVCVEVAGVKDKITVEPGETWEASQTISYSAI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccacgacgccctcgtcggcacgctccccggcgttcgcctcgaaaatgacacc
cacgtgtgtgaaatcactcgcttcggcgcgcacgtcgcgtcgtggcgcgtcaaacgcacg
agcgatgagcttttgtttcgctcaaagttggccaagctcgacggaacgaaagccattcgc
ggcggcgtgccggtgtgtttcccgcaattcagcgacatggggccgtgcgcgcagtcgcac
gggttcgcgcgaacgtccgtgtgggccgtggaggcgctgagcgcgacggaggtgacgatg
gtgctgcgacgcggtgacgaggcgggcgacggcgacgcgttcggcggcgactacgaggcg
cggttcacggcgacgctcgacggtgacgcgttgcgcacggcgttgcgcgtaacgaacgct
gggaagagttgtttcgagtttacgtcggcgttgcacacgtacttcagggtttcagattgc
gcgaagaccaaggtgcgcgggttgcgcgggacgacgtatttagacaatttgcgcgcgaga
gcgagcgcgaaggacgacgaagacgcggtggagttttctggcgaggtggataggatctat
accgacgcgccgagcgtgttgactatagacgatgaggctctcgggcggaggtttcgcgtt
gcaaagacgtcgacgtttccggacgccgtcgtgtggaatccggcgttgacggacaagacg
cgaggcatgagcgactttggcgacgaggaataccgcgagatggtgtgcgtcgaagtcgcc
ggagtgaaggataagatcaccgtggagccaggagagacgtgggaggcatcgcagacgatt
agctatagcgcgatttaa

DBGET integrated database retrieval system