KEGG   Ostreococcus lucimarinus: OSTLU_36521Help
Entry
OSTLU_36521       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00010  Glycolysis / Gluconeogenesis
olu00051  Fructose and mannose metabolism
olu00562  Inositol phosphate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
olu01230  Biosynthesis of amino acids
Module
olu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_36521
   00051 Fructose and mannose metabolism
    OSTLU_36521
   00562 Inositol phosphate metabolism
    OSTLU_36521
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_36521
Enzymes [BR:olu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OSTLU_36521
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OSTLU_36521
  Exosomal proteins of bladder cancer cells
   OSTLU_36521
  Exosomal proteins of melanoma cells
   OSTLU_36521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 5006927
NCBI-ProteinID: XP_001422959
JGI: 36521
UniProt: A4SC14
Position
21:complement(309837..>310637)
Genome map
AA seq 266 aa AA seqDB search
AAAQRRSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDADVDVYVAPPFVFIP
RVQKELNNKNYAVAAQNCWVSAGGAFTGEVSADMLADADIPWVILGHSERRALCGETNEF
VGEKTKYALSKGLKVALCIGETLEQREAGTTLDICRAQLKAVNDVVTAADWENIVIAYEP
VWAIGTGKVATPDQAQEVHAGIRKWCADNISPAIASKIRIQYGGSVNAGNCDELAQKEDI
DGFLVGGASLIGEAFVTICNSAKHSK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gccgcagcgcagcgacgaagcgtcgtcgtgaatgcgggcacgggtaaatttatcgtcggc
gggaactggaagtgcaacggcacggcggagtccgtcaagtcgctcgtgaaggaactaaac
tctgggaaaatcgacgccgacgttgacgtctacgtcgcgcctccgttcgtcttcattcct
cgagtgcaaaaggagctcaacaacaaaaactacgccgtcgccgcgcagaactgttgggtc
tccgcgggtggggcgttcacgggtgaggtgagcgcggatatgctcgccgacgccgacatt
ccgtgggtgattctcgggcacagcgaacgccgcgcgctctgcggcgagacgaacgagttc
gtcggggagaagaccaaatatgccttgagcaagggattgaaggttgctttgtgcatcggt
gagacgttggaacagcgcgaagcgggcacgactctggatatttgccgcgcgcaactcaag
gcggtgaacgacgtcgtgaccgcggcggactgggaaaacatcgtcatcgcgtacgagccc
gtttgggcgatcggtaccggcaaggtcgcgacgccggaccaagcgcaagaagtgcacgcg
ggcattcgcaagtggtgcgcggataatatttctccggcgattgcgtcgaagattcgcatt
cagtacggcggcagcgtcaacgccggcaactgcgacgaattagctcagaaagaggacatt
gacggctttctcgtcggcggcgcgtctttgatcggcgaggctttcgtgacgatttgcaac
agcgccaagcactctaagtga

DBGET integrated database retrieval system