KEGG   Ostreococcus lucimarinus: OSTLU_36777Help
Entry
OSTLU_36777       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OSTLU_36777
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OSTLU_36777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 5006988
NCBI-ProteinID: XP_001422930
JGI: 36777
UniProt: A4S6L1
Position
21:complement(<227536..228603)
Genome map
AA seq 356 aa AA seqDB search
MRRARRARRLALGAALTALARVALARADRASIAVVGSVNADVIARVGTSVPRRGETRAAT
AARVERACGGKGANQAVAASRLTCERGGKAAFVGRFGEDEAGTTLRRALRRETDVSGSVT
MARGSGIETGMGFVMLTDDGSPSAVVVGGANALGWNADDEALASEFREALRGAKTVMLQR
EVPERVNVIAATVAREIGVRTIVLDAGGSFHAADEALLALVDYVAPNESELAGMAGMRVE
EVSSGDEAVVKAARIVAGTSRVAVLCTLGSRGSLLVRGEDVTRVESMELPAGAKEVDATA
AGDAFRAAFAVAMAENKNERDAMKFASAAGALAVTKLGAMPSLPFRSDVDEFLGVS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgcgcgtcgcgcgcggcgcctcgcgctcggcgccgcgctgaccgcgctcgcg
cgcgtcgcgctcgcgcgcgccgaccgcgcgtcgatcgccgtcgtggggagcgtgaacgcc
gacgtcatcgcgcgcgtcggaacatcggtcccgcgccgcggagaaacgcgcgcggcgacg
gcggcgcgcgtcgagcgcgcgtgcggagggaagggagcgaatcaagcggtcgcggcgtcg
cgattgacgtgcgagcgcggcgggaaggcggcgttcgtgggacgattcggggaggacgag
gcggggacgacgctgcgacgcgcgctgcggcgagagacggatgtgtccgggagcgtcacg
atggcgcgagggagcggaatcgagacgggaatggggttcgtgatgctgacggacgatgga
tcgccgagcgcggtggtcgtggggggggcgaacgcgctcggatggaacgcggacgacgag
gcgctggcgagcgagtttcgcgaggcgctgcgaggcgcgaagacggtgatgctgcagcgg
gaggtgccggaacgcgtgaacgtgatagcggcgacggttgcgagggaaatcggtgtgcga
acgatcgtgctggacgcgggaggctcgtttcacgcggcggatgaggcgttgttggcgctc
gtggattacgtcgcgccgaacgagagcgaactcgcgggaatggcgggaatgcgcgtggag
gaggtttcttctggggacgaagcggtcgttaaggcggcgagaatcgtcgcaggaacgtcg
cgcgtcgccgttctgtgcacgctggggagtcgaggatcgttgctcgtgagaggcgaagac
gtcacgagagtcgaatcgatggaacttccggccggcgccaaagaagtggacgccaccgcg
gctggtgatgcgtttcgcgccgcgttcgcggtggcgatggctgaaaataaaaacgagcgc
gacgccatgaagttcgccagcgccgcgggggctttggcggtgacgaagttgggtgcgatg
ccaagccttccatttcggagcgacgtggatgaatttcttggcgtttca

DBGET integrated database retrieval system