KEGG   Ostreococcus lucimarinus: OSTLU_36777Help
Entry
OSTLU_36777       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
olu  Ostreococcus lucimarinus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OSTLU_36777
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OSTLU_36777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21
AA seq 356 aa AA seqDB search
MRRARRARRLALGAALTALARVALARADRASIAVVGSVNADVIARVGTSVPRRGETRAAT
AARVERACGGKGANQAVAASRLTCERGGKAAFVGRFGEDEAGTTLRRALRRETDVSGSVT
MARGSGIETGMGFVMLTDDGSPSAVVVGGANALGWNADDEALASEFREALRGAKTVMLQR
EVPERVNVIAATVAREIGVRTIVLDAGGSFHAADEALLALVDYVAPNESELAGMAGMRVE
EVSSGDEAVVKAARIVAGTSRVAVLCTLGSRGSLLVRGEDVTRVESMELPAGAKEVDATA
AGDAFRAAFAVAMAENKNERDAMKFASAAGALAVTKLGAMPSLPFRSDVDEFLGVS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgcgcgtcgcgcgcggcgcctcgcgctcggcgccgcgctgaccgcgctcgcg
cgcgtcgcgctcgcgcgcgccgaccgcgcgtcgatcgccgtcgtggggagcgtgaacgcc
gacgtcatcgcgcgcgtcggaacatcggtcccgcgccgcggagaaacgcgcgcggcgacg
gcggcgcgcgtcgagcgcgcgtgcggagggaagggagcgaatcaagcggtcgcggcgtcg
cgattgacgtgcgagcgcggcgggaaggcggcgttcgtgggacgattcggggaggacgag
gcggggacgacgctgcgacgcgcgctgcggcgagagacggatgtgtccgggagcgtcacg
atggcgcgagggagcggaatcgagacgggaatggggttcgtgatgctgacggacgatgga
tcgccgagcgcggtggtcgtggggggggcgaacgcgctcggatggaacgcggacgacgag
gcgctggcgagcgagtttcgcgaggcgctgcgaggcgcgaagacggtgatgctgcagcgg
gaggtgccggaacgcgtgaacgtgatagcggcgacggttgcgagggaaatcggtgtgcga
acgatcgtgctggacgcgggaggctcgtttcacgcggcggatgaggcgttgttggcgctc
gtggattacgtcgcgccgaacgagagcgaactcgcgggaatggcgggaatgcgcgtggag
gaggtttcttctggggacgaagcggtcgttaaggcggcgagaatcgtcgcaggaacgtcg
cgcgtcgccgttctgtgcacgctggggagtcgaggatcgttgctcgtgagaggcgaagac
gtcacgagagtcgaatcgatggaacttccggccggcgccaaagaagtggacgccaccgcg
gctggtgatgcgtttcgcgccgcgttcgcggtggcgatggctgaaaataaaaacgagcgc
gacgccatgaagttcgccagcgccgcgggggctttggcggtgacgaagttgggtgcgatg
ccaagccttccatttcggagcgacgtggatgaatttcttggcgtttca

DBGET integrated database retrieval system