KEGG   Ostreococcus lucimarinus: OSTLU_36983Help
Entry
OSTLU_36983       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
olu  Ostreococcus lucimarinus
Brite
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     OSTLU_36983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_7 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 5001316
NCBI-ProteinID: XP_001417474
JGI: 36983
UniProt: A4RVU9
Position
4:complement(<306094..306423)
Genome map
AA seq 110 aa AA seqDB search
MLKKIRKQFVKFDIDRSGTIDREELCAVVGIDRRSLWTRKLLDFFDTDGDAQVSFEEFIS
TLGILGARVDKYASGHGRGHRIPKEVFFIVALLDLDGDGELNRGELAPVL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaaattcgaaagcagtttgtaaagttcgacatcgatagatcggggacgatc
gaccgcgaggagctgtgcgcggtcgtcggtatcgaccgtcggagcctttggacgcgaaag
ctgctggactttttcgacacggatggcgatgcccaagtgagctttgaagagttcatttcc
acactcgggatactcggcgcgcgagtggacaagtacgcgagtggacacgggcgaggacac
agaattccgaaagaggtgtttttcatagtcgctcttttggatctcgatggcgatggtgag
ttgaaccgcggggagttagcgccggtgctt

DBGET integrated database retrieval system