KEGG   Ostreococcus lucimarinus: OSTLU_36983Help
Entry
OSTLU_36983       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 110 aa AA seqDB search
MLKKIRKQFVKFDIDRSGTIDREELCAVVGIDRRSLWTRKLLDFFDTDGDAQVSFEEFIS
TLGILGARVDKYASGHGRGHRIPKEVFFIVALLDLDGDGELNRGELAPVL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaaattcgaaagcagtttgtaaagttcgacatcgatagatcggggacgatc
gaccgcgaggagctgtgcgcggtcgtcggtatcgaccgtcggagcctttggacgcgaaag
ctgctggactttttcgacacggatggcgatgcccaagtgagctttgaagagttcatttcc
acactcgggatactcggcgcgcgagtggacaagtacgcgagtggacacgggcgaggacac
agaattccgaaagaggtgtttttcatagtcgctcttttggatctcgatggcgatggtgag
ttgaaccgcggggagttagcgccggtgctt

DBGET integrated database retrieval system