KEGG   Ostreococcus lucimarinus: OSTLU_37913Help
Entry
OSTLU_37913       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
olu  Ostreococcus lucimarinus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:olu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:olu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 495 aa AA seqDB search
MAPARDAATASTSAADGAFVAFLCALAPRELDALYASSPWSALAVLRACDSIAKQIILRL
AYVDDGADARECAKWCGDGASDARALERAMARLARLRVTTALGEGEDARVVANEAFANNL
RRALERGFVNLDDGDGADAREDAGVAAKVPDRATLNAYAKAKWEDLLLTLTGASNAFSRP
GAKVKGRLDAQALFRAAGLTTATTAALKKGGQKRLKNAGVTAEGFAFLLQTAQEQIWVLL
TQYIRDSQKTSATSAISFLLRLTFQEPGRAYAMTGVLSDTEQDVVLDLTHLGLLYTFEVK
KKFYYVPTLLASGLSGGFTGDDGDTKAAAAAAEGHIIVETNYRVYAYTSSAVEMEILRLF
TRADYRLPNLYVGMLTRESVQNALRAGVDAEQIVGYIRAHAHKQVRRKKPSVPSTVCDQI
RLWARDMERMEAEECVLYCDFPQAGTFYGAVVSEAEKRGALLWRDDASRRLTVRASAHDE
MKAVVGALKQKLDAV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggcgcgcgacgcggcgacggcgtcgacgagcgcggccgacggcgcgttcgtc
gcgtttctgtgcgcgctcgcgccgcgcgagctggacgcgctgtacgcgtcgtcgccgtgg
agcgcgctcgcggtgctgcgcgcgtgcgattcgatcgcgaaacaaatcatcctgcgcctg
gcgtacgtcgacgacggcgcggacgcgcgcgagtgcgcgaagtggtgcggcgacggcgcg
agcgatgcgcgcgcgctggagcgcgcgatggcgcggttggcgcggttgagggtgacgacg
gcgctgggcgagggcgaagacgcgcgcgtcgtcgcgaacgaggcgttcgcgaataatctg
cgacgcgcgctcgagcgaggattcgtgaatttggacgatggcgacggggcagacgcgcgg
gaggacgcgggcgtggcggccaaggtgccggatcgagcgacgctgaacgcgtacgcgaag
gcgaagtgggaagacttgctgctcacgctcacgggggcgtcgaacgcgttctcgaggccg
ggggccaaggtgaagggacgattggacgcgcaggcgctgtttcgagccgcggggctgacg
acggcgacgacggcggcgctgaagaagggcggacagaagcggttgaagaacgcgggcgtc
accgcggagggattcgcgtttttgttgcagacggcgcaagagcaaatatgggtgctgttg
acgcagtacatacgcgattcgcagaagacgtcggcgacgagcgcgatcagtttcttgctc
aggctgacgtttcaggaaccggggcgcgcgtacgcgatgacgggggtgctgagcgacacg
gagcaagacgtcgtgctcgatttgacgcatctcgggttgctgtacacgtttgaggtgaag
aaaaagttctactacgtccccacgctcctcgccagtggcttgtccggcggattcaccggg
gatgacggcgataccaaggcggcggcggcggcggcggaaggacacatcatagtcgagacg
aattatcgcgtgtacgcgtacacgtccagcgccgtggagatggagattttgcggctgttc
acgcgcgcggattatcgcttgcccaacttgtacgtcggtatgttgacgcgcgagagcgtg
caaaacgcacttcgcgcgggtgtggacgcagaacagatcgtggggtacattcgcgcgcac
gcgcacaagcaagttcgccgaaaaaagccgagtgtaccgagcacggtgtgcgaccaaatt
cgtctttgggcgcgcgacatggaacgcatggaagcagaggaatgcgtgctgtactgcgat
ttcccgcaggccggtactttttacggcgccgtcgtgagcgaggcggaaaaacgaggcgcg
ctgttgtggcgagacgacgcgtcgaggcggttgactgtccgcgcgtcggcgcacgacgag
atgaaagccgtcgtcggcgcgctgaagcaaaagttagacgcggtgtaa

DBGET integrated database retrieval system