KEGG   Ostreococcus lucimarinus: OSTLU_38488Help
Entry
OSTLU_38488       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00860  Porphyrin and chlorophyll metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_38488
Enzymes [BR:olu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OSTLU_38488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase VWA_2 VWA AAA_5 MCM Sigma54_activat PAXIP1_C CCDC53 VWA_3 CAP_N
Motif
Other DBs
NCBI-GeneID: 5001935
NCBI-ProteinID: XP_001418124
JGI: 38488
UniProt: A4RY81
Position
5:complement(835555..837606)
Genome map
AA seq 683 aa AA seqDB search
MRQTFPLAAVIGQEKIKSALLLGGIDPTLGGIAISGRRGTAKSIMARGLHALLPPIECVK
DSYCNADPSKPDEWEEGLSEKVTRNADGNVETIIRDAPFVQLPLGVTEDRLIGTVDIEES
MKQGKTIFQPGLLAQAHRGILYVDEINLLDDGVANLLLSVLAEGENVVEREGITLKHPCK
PLLIATFNPEEGNLREHLLDRIAVTLSADQMLTFEDRVEAVSQAMNFQNAAENSVKSVEE
ATEGIKTNIILAREWLKDCTISQDQVEYLVRESIRGQIQGHRAELFAVKAAKALAALDGR
SKVNADDLKEAVRLVIVPRSDILQDAPPPDEDDMQEPPPPPPPPQDNAEDEDQDEENEEE
NEEDEEEEDDIPDVPEEFIFDAEGVILDKDVTQFAQQTNRQGGRSGRSKSVIFSTDRGRY
IKPILPKGKTIRLAVDATLRAAAPYQSARRERDPNAEKKKVYVEKGDMRAKKLARKSGAL
VIFLVDASGSMALNRMQGAKGAALSILESSYQSRDMVSIVPFRGDEAEVLLPPSRSIAMA
RNRLDTMACGGGSPLAHGLSVAARVGLNAMSTGDVGRVMIVCLTDGRANVSINKSQRDPE
YLGPDAKKPTNEELEQEVADTAARIGAAGMSVLVIDTENKFLSSGTAEKLAQNAQGKYYY
LPNGTEREIAAATASAMAEAKSI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagacgttcccgctcgcggcggtgatcgggcaggaaaagatcaagtcggcgctg
cttttgggagggatcgacccgacgttgggagggatcgcgatctcgggacgacgaggaacg
gcgaaatccatcatggctcgcggtttgcacgcgctgttaccgccgatcgagtgcgtgaag
gattcgtattgcaacgccgacccgtccaagccggatgagtgggaggaggggttgagcgaa
aaggtaacgaggaacgccgacgggaacgtggagacgatcatccgcgacgcgccgttcgtg
cagctcccgctcggagtgacggaagatcgtttgatcggtacggtcgacatcgaagagtcc
atgaagcaagggaagacgattttccaacccgggctgttggcgcaggcgcacaggggcatc
ctttatgtcgacgaaatcaacctcctcgacgacggggtcgccaacttgttgctttccgtg
cttgccgagggtgaaaacgtcgtcgagcgcgaaggcatcacgctcaagcacccgtgtaag
ccgcttttgatcgcgacgtttaacccggaggagggtaaccttcgcgagcacctgttggac
cgcatcgcggtgacgctctcggcggatcagatgttgacatttgaggaccgcgtcgaggcg
gttagccaagcgatgaacttccaaaacgcggccgaaaactcggtgaagagcgtggaagag
gcgacggaaggtatcaagacgaacatcatcttggcgcgcgagtggttgaaggattgcacg
atttcgcaagatcaagtcgagtacttggtgcgcgagtccattcgcggtcagattcaaggt
catcgcgccgaacttttcgccgtcaaggcggccaaggcactcgccgcactcgacggtcga
tccaaggtgaacgctgacgacttgaaggaagccgtgcgattggttatcgtaccgcgctct
gatattttgcaagacgcgccgccgccggatgaagacgacatgcaggaaccgccgccgcca
ccgccgccgccgcaagataacgcggaagacgaagaccaagatgaagagaacgaggaagag
aacgaggaagacgaggaagaagaggacgatattccggacgttccggaggagttcatcttt
gacgccgagggcgtcatcctcgacaaggatgtgactcagttcgcgcaacaaaccaacaga
caaggcggccgctccggtcgttcgaagagcgtcattttctccaccgatcgtggtcgctat
attaagcccattttacccaagggtaagacgattcgtttggcggttgacgcgacgttgcgc
gccgctgctccgtaccaaagcgctcgacgcgagcgcgatcccaacgcggagaagaagaag
gtttatgtcgaaaagggtgacatgcgagcgaagaagctcgcgcgtaaatccggtgcattg
gtcattttcctcgtcgatgcctccggttcgatggcgttgaacagaatgcaaggcgcgaag
ggcgccgcactttcaatcttggaaagctcgtaccaaagccgcgacatggtgtccatcgtc
cctttccgaggtgacgaagctgaagtgctcttgccgccgtcgcgatcgatcgcgatggcg
agaaaccgtctcgacaccatggcgtgcggtggtggttcccccttagcgcacgggttgtcc
gtcgcggcgcgcgtcggactcaacgccatgtccacgggagacgtcggacgcgtcatgatt
gtgtgcctcaccgacggtcgcgccaacgtgtccatcaacaagtcgcaacgagatccggag
tatctcggccccgacgccaagaagcccacgaacgaagagctcgaacaggaagtggctgac
acggcggcgagaatcggcgccgccggtatgtcggtgctcgtcattgacaccgaaaacaag
ttcctttcgtctggcaccgccgagaagctcgcccaaaacgcccaaggcaagtactactac
ttgccgaacggtaccgagagagagattgcggcggcgacggcttcggcaatggcggaagcc
aagtcgatttag

DBGET integrated database retrieval system