KEGG   Ostreococcus lucimarinus: OSTLU_3954Help
Entry
OSTLU_3954        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     OSTLU_3954
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   OSTLU_3954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 344 aa AA seqDB search
KTLGDAFPPSAKFFGLENFGNTCYCNSVLQALYACDEFRERLIEHHAAANDGTSTSGRGK
ETPDSMLAALGDLFREISGQTKRTGYVSPRAFIERLRKDNVLFRGHMHQDAHEFLNFLLN
ECCENLQTKLKRDGAWEPGKKTWIHDVFEGKLANQTRCLWCENTTNREECFLDLSVDVEQ
NTSITACLNNFSAKELLDKNDKFQCDRCGGLHEAQKRMLIHEAPKVLSLHLKRFKYIEAL
GRHAKLNHRVVFPSELKIPNLIDEAENPDASYKLFAVVVHIGSGPNHGHYVCFAKNNHRW
FLYDDDCVEVVDEEQLQQVFGSTTDGGSAGSEHGYILFYARSEG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
aagacgctcggcgacgcgttcccaccgtcggcaaagttttttggattggaaaactttggc
aacacgtgctactgtaactcggtgctccaggcgctgtacgcgtgcgatgagtttcgagaa
cgattgatcgaacatcacgcggcggcgaacgatgggacgtcgacgagcggacgaggaaag
gagacgcccgacagcatgctggcggcgctcggggatctgtttcgagagatttcgggacaa
acgaaacgcacgggatacgtcagcccgagggcgttcatcgaacggttgaggaaggataac
gtgttgtttcgaggacacatgcatcaggatgcgcacgagtttttaaacttcttgctgaat
gagtgttgcgaaaatttacagacgaagttgaagcgagacggcgcgtgggaaccggggaag
aagacgtggatacacgatgtgttcgaggggaaactggcgaatcagacgcggtgtttatgg
tgtgagaacacgacgaatagagaggagtgctttttggacctgtcggttgatgtcgagcag
aacacttccatcacggcgtgcttgaataatttcagcgccaaggagttgttggacaaaaac
gacaagtttcagtgcgatcgatgcggtgggttacacgaggcgcagaagcgaatgctgatt
catgaagcgccgaaagtattgtcgttacacttgaagcggttcaagtacatcgaggcgctc
ggcaggcacgcgaaactgaatcatcgcgtggtgttcccttccgaattgaaaattcccaac
ttgatagacgaagcggagaatcccgatgcgagttataagcttttcgccgtcgtcgttcac
atcggctccgggcctaatcacggacactacgtgtgtttcgccaagaataatcatcgctgg
ttcttgtacgatgacgattgcgttgaagtcgtggatgaagagcagcttcaacaagtcttt
ggctcgacgacggatggcggctccgcggggagcgagcacggatacattttgttctacgcc
cgatctgaaggt

DBGET integrated database retrieval system