KEGG   Ostreococcus lucimarinus: OSTLU_39993Help
Entry
OSTLU_39993       CDS       T01029                                 

Definition
(RefSeq) predicted protein
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1 USP7_C2 Exo84_C
Motif
Other DBs
NCBI-GeneID: 4999679
NCBI-ProteinID: XP_001415532
JGI: 39993
UniProt: A4RR96
Position
1:554540..556606
Genome map
AA seq 688 aa AA seqDB search
MEDTTFGCDVSLTPKNDVTTCAEEAKVGTRGKAGLSNLGNTCFMNSALQCLSHSSLLTDY
FLSDKYEVDINTDNPIGMGGELAKEYANLIGALWRDGALTVTPRKFKSSLARFAPQFSGY
MQQDAQELLAFLLDGLHEDLNRVKNKPYATERDAEGRSDEDVANESWEAHTARNNSCIVD
TFQGQYRSKLVCPSCSNKSVKFDPFMYLSIPVPSARERMIKVTLVSYGDELSAITYGLKL
PKNGEIAMLLSALCEAADIDTMDERVVLCEVYNHRMEKTLSNMSYSLTDIRERDVIYAHR
LPAIKDNDNVETVDTVLVHRKELNQNKTPYSHVSSVAATTMVRFGFPWIVPVSVPKGTKA
GPDHARFVEKEVEKFSAKFAHTNSMEKSCSPTTSGDTEGSASRRAVAEKDSRLFKMKYTN
KSASASFHEYGSTTASTSDSHEMQYTIASSMHCVAIDWSSKALSQFFDEELLEREIEEHP
SVTENAIENSGTQGTPLASCIESFIQEEPLGKDDMWYCKQCKDHVQAMKKLDLWRMPPIL
VMHLKRFSYSRTWRDKIDTLIDFPLNTLDMTPYVLPNASSGPAPIYDLYAVVNHFGGMGG
GHYTAYTRHAEEGTWHLYDDSRCTAVDVGAALNNSAAYVLFYKRRDVPMRQAMSRAGSLC
NMAAMDSVANTRTPCDDDDDEPREMELN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggaagacacgacttttggatgcgatgtgagtttgacgccaaagaacgacgtgacgact
tgcgctgaggaggcaaaagtaggaacgaggggcaaagccggactgagcaatctcgggaat
acgtgctttatgaatagcgcattgcagtgtctcagtcactcttcgcttttgacggattac
tttctgtccgataaatacgaagtggacattaatacggacaatcccatcggtatgggcggg
gagctggcgaaggagtacgcgaatttgataggcgcactttggcgggacggcgcgctcacg
gtcacgccgcgcaagttcaagtcttccttggctcgtttcgcgcctcagttcagtggatat
atgcaacaagatgcacaagagctgttggcgtttttactagatggcttgcacgaagattta
aatcgcgtcaagaacaaaccgtacgccacagagcgagacgcggagggaagaagcgacgag
gacgttgcaaacgaatcttgggaagcacacacggctcgcaacaattcttgcatcgtcgat
acttttcagggtcagtatcgatcgaagttggtttgcccgtcatgcagcaacaaatcggtc
aagttcgatccgttcatgtacctttccattccggtcccgtcggctcgtgagcgcatgatt
aaagtcacactcgtatcgtacggcgacgaactttctgcaatcacgtacggtttgaaactg
cctaagaatggtgagattgccatgttacttagtgctctatgcgaagccgctgatatcgat
acgatggacgaacgtgtggtactttgcgaagtgtacaatcatcgaatggaaaagactctt
tcgaacatgtcctactcactcacagacatcagagaacgcgacgtgatatacgcgcaccgc
ttaccggcgataaaagacaacgacaacgtggaaacagtcgacaccgttcttgtgcacaga
aaagagttgaatcaaaacaagacgccgtattcgcacgttagctccgtggcggcgacgacg
atggtccgatttggctttccgtggatcgttccagtgagcgtgccaaaaggcacgaaggct
ggtcccgaccacgcgagattcgtagagaaggaggtggaaaagtttagcgcaaagtttgca
cacacaaattcgatggagaaatcgtgttcgcctaccacgagcggcgatacagaaggaagt
gcgtctcgacgcgccgtcgcagaaaaggactctcgactcttcaaaatgaagtacacgaat
aagagcgcctcggcatcgttccacgagtatggttcaacgaccgcatcgacgtcggactcg
cacgaaatgcagtacaccatcgcctcctccatgcattgcgttgcgatagactggtcttcg
aaggctctgagccagttctttgacgaagaattgttggagcgtgaaatcgaggagcaccca
agcgtgacggagaacgcgattgagaacagcgggactcaaggcacaccactagcgtcgtgc
atcgagtctttcattcaagaagagccgctcggtaaggatgacatgtggtattgcaagcag
tgcaaggaccacgtccaggcgatgaaaaagctcgatttgtggcgcatgccgccgattctc
gtcatgcacctcaagcgtttcagctacagtcgaacgtggcgagataagatcgatacgttg
attgattttccactcaacacgcttgacatgacgccttacgtactcccgaacgcttccagt
gggccggcgccgatttatgacttgtacgcggtggtgaaccactttggcggcatgggcggc
ggtcattacaccgcgtacacgagacacgccgaggagggcacgtggcacttgtacgacgat
agtcgttgtaccgcagtagacgtcggtgcggcgctgaacaacagcgcggcttacgtcttg
ttctacaagcgccgcgacgtcccgatgcgccaagccatgtctcgcgccggctcgctgtgc
aacatggccgccatggacagcgtcgcgaacacgcgtaccccatgcgacgacgacgacgac
gaacctagagaaatggaactcaactag

DBGET integrated database retrieval system