KEGG   Ostreococcus lucimarinus: OSTLU_39993Help
Entry
OSTLU_39993       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     OSTLU_39993
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   OSTLU_39993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 688 aa AA seqDB search
MEDTTFGCDVSLTPKNDVTTCAEEAKVGTRGKAGLSNLGNTCFMNSALQCLSHSSLLTDY
FLSDKYEVDINTDNPIGMGGELAKEYANLIGALWRDGALTVTPRKFKSSLARFAPQFSGY
MQQDAQELLAFLLDGLHEDLNRVKNKPYATERDAEGRSDEDVANESWEAHTARNNSCIVD
TFQGQYRSKLVCPSCSNKSVKFDPFMYLSIPVPSARERMIKVTLVSYGDELSAITYGLKL
PKNGEIAMLLSALCEAADIDTMDERVVLCEVYNHRMEKTLSNMSYSLTDIRERDVIYAHR
LPAIKDNDNVETVDTVLVHRKELNQNKTPYSHVSSVAATTMVRFGFPWIVPVSVPKGTKA
GPDHARFVEKEVEKFSAKFAHTNSMEKSCSPTTSGDTEGSASRRAVAEKDSRLFKMKYTN
KSASASFHEYGSTTASTSDSHEMQYTIASSMHCVAIDWSSKALSQFFDEELLEREIEEHP
SVTENAIENSGTQGTPLASCIESFIQEEPLGKDDMWYCKQCKDHVQAMKKLDLWRMPPIL
VMHLKRFSYSRTWRDKIDTLIDFPLNTLDMTPYVLPNASSGPAPIYDLYAVVNHFGGMGG
GHYTAYTRHAEEGTWHLYDDSRCTAVDVGAALNNSAAYVLFYKRRDVPMRQAMSRAGSLC
NMAAMDSVANTRTPCDDDDDEPREMELN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggaagacacgacttttggatgcgatgtgagtttgacgccaaagaacgacgtgacgact
tgcgctgaggaggcaaaagtaggaacgaggggcaaagccggactgagcaatctcgggaat
acgtgctttatgaatagcgcattgcagtgtctcagtcactcttcgcttttgacggattac
tttctgtccgataaatacgaagtggacattaatacggacaatcccatcggtatgggcggg
gagctggcgaaggagtacgcgaatttgataggcgcactttggcgggacggcgcgctcacg
gtcacgccgcgcaagttcaagtcttccttggctcgtttcgcgcctcagttcagtggatat
atgcaacaagatgcacaagagctgttggcgtttttactagatggcttgcacgaagattta
aatcgcgtcaagaacaaaccgtacgccacagagcgagacgcggagggaagaagcgacgag
gacgttgcaaacgaatcttgggaagcacacacggctcgcaacaattcttgcatcgtcgat
acttttcagggtcagtatcgatcgaagttggtttgcccgtcatgcagcaacaaatcggtc
aagttcgatccgttcatgtacctttccattccggtcccgtcggctcgtgagcgcatgatt
aaagtcacactcgtatcgtacggcgacgaactttctgcaatcacgtacggtttgaaactg
cctaagaatggtgagattgccatgttacttagtgctctatgcgaagccgctgatatcgat
acgatggacgaacgtgtggtactttgcgaagtgtacaatcatcgaatggaaaagactctt
tcgaacatgtcctactcactcacagacatcagagaacgcgacgtgatatacgcgcaccgc
ttaccggcgataaaagacaacgacaacgtggaaacagtcgacaccgttcttgtgcacaga
aaagagttgaatcaaaacaagacgccgtattcgcacgttagctccgtggcggcgacgacg
atggtccgatttggctttccgtggatcgttccagtgagcgtgccaaaaggcacgaaggct
ggtcccgaccacgcgagattcgtagagaaggaggtggaaaagtttagcgcaaagtttgca
cacacaaattcgatggagaaatcgtgttcgcctaccacgagcggcgatacagaaggaagt
gcgtctcgacgcgccgtcgcagaaaaggactctcgactcttcaaaatgaagtacacgaat
aagagcgcctcggcatcgttccacgagtatggttcaacgaccgcatcgacgtcggactcg
cacgaaatgcagtacaccatcgcctcctccatgcattgcgttgcgatagactggtcttcg
aaggctctgagccagttctttgacgaagaattgttggagcgtgaaatcgaggagcaccca
agcgtgacggagaacgcgattgagaacagcgggactcaaggcacaccactagcgtcgtgc
atcgagtctttcattcaagaagagccgctcggtaaggatgacatgtggtattgcaagcag
tgcaaggaccacgtccaggcgatgaaaaagctcgatttgtggcgcatgccgccgattctc
gtcatgcacctcaagcgtttcagctacagtcgaacgtggcgagataagatcgatacgttg
attgattttccactcaacacgcttgacatgacgccttacgtactcccgaacgcttccagt
gggccggcgccgatttatgacttgtacgcggtggtgaaccactttggcggcatgggcggc
ggtcattacaccgcgtacacgagacacgccgaggagggcacgtggcacttgtacgacgat
agtcgttgtaccgcagtagacgtcggtgcggcgctgaacaacagcgcggcttacgtcttg
ttctacaagcgccgcgacgtcccgatgcgccaagccatgtctcgcgccggctcgctgtgc
aacatggccgccatggacagcgtcgcgaacacgcgtaccccatgcgacgacgacgacgac
gaacctagagaaatggaactcaactag

DBGET integrated database retrieval system