KEGG   Ostreococcus lucimarinus: OSTLU_40924Help
Entry
OSTLU_40924       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
olu  Ostreococcus lucimarinus
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    OSTLU_40924
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     OSTLU_40924
Ubiquitin system [BR:olu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     OSTLU_40924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 375 aa AA seqDB search
MANLSQVPEDGEVSYESGHYSDQRDQGTWSWQPARTAEGAVLAFKELRPLAEGLRHLAMY
RCEEAIHSFQQLSRSQYDTAYVLCAMAKAHSEMVDYANAAQAFEEARAAAPYRLEGLDVY
STVLWHLKEEVKLAHLAQEVQSLDRLAPETWCVLGNCFSLQKEHETALKFFQRAIQLDPK
CTYAHTLSGHEYFANEDFEKSMNCYRAALRLDARHYNAWYGLGTVYYRQEKYVMSEYHFT
YALNINPKSSVLYCYAGMAKHALNDNDAALSLLSQAIALDGKNPLARYEMAAVLMSEENY
DAALAELNKLQEIAPKEASVFFLMGRIYKKLGLQEKAMINFSIALDLRPSNADVNSIKGA
IEKLDADELSDEDNI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctgagtcaagtcccggaagacggtgaagtttcgtatgaaagtggtcattac
agcgatcagcgcgatcagggtacttggagttggcagcccgcgcgaacagccgagggcgcc
gtgttggcgttcaaagagctgcgtccgctcgcggagggtctgaggcatctcgccatgtat
cgatgcgaagaagcgatccattcgtttcaacagctttcgcgatctcaatacgacaccgcc
tatgtgctgtgcgcgatggcgaaagcgcactcagagatggtggattacgccaacgcagcg
caggcgtttgaagaagcgcgcgcggccgcgccgtatcgcttggaaggtctcgatgtgtac
tcaaccgttctttggcatttgaaggaggaagtgaagctcgcacatttggcacaagaagtt
cagtctctcgatcgtctagctccagaaacgtggtgcgtgctcggaaactgtttctcgtta
caaaaggaacacgagacggctttgaaattttttcagcgcgccatccaactcgatccgaag
tgcacgtacgcgcatacgctgagcggacacgagtactttgcgaacgaagactttgaaaaa
agtatgaattgctatcgggctgcgttgagattagatgcgagacattacaacgcctggtac
ggcctcggtacggtgtattaccgccaagaaaagtacgtcatgagcgagtatcacttcaca
tacgcgctcaacatcaatccgaagtcgagcgtgttgtactgctacgccggtatggcaaag
catgcactaaacgataacgatgcagcgttatcgcttctctctcaagcgatcgcgctcgat
ggtaagaatcctctggctcgttacgaaatggccgccgtgttgatgagcgaagaaaattac
gacgccgcgttggcggagcttaacaaattgcaagagatcgcccccaaggaagcgagcgtg
ttttttctcatgggaagaatctacaaaaagcttgggcttcaagagaaagcgatgattaac
tttagcatcgcgctcgatttgcgtccatcgaacgcggacgtgaactcgatcaagggcgcc
atcgagaaactcgacgccgatgagctcagcgacgaggacaacatctga

DBGET integrated database retrieval system