KEGG   Ostreococcus lucimarinus: OSTLU_40924Help
Entry
OSTLU_40924       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
olu  Ostreococcus lucimarinus
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:olu04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 375 aa AA seqDB search
MANLSQVPEDGEVSYESGHYSDQRDQGTWSWQPARTAEGAVLAFKELRPLAEGLRHLAMY
RCEEAIHSFQQLSRSQYDTAYVLCAMAKAHSEMVDYANAAQAFEEARAAAPYRLEGLDVY
STVLWHLKEEVKLAHLAQEVQSLDRLAPETWCVLGNCFSLQKEHETALKFFQRAIQLDPK
CTYAHTLSGHEYFANEDFEKSMNCYRAALRLDARHYNAWYGLGTVYYRQEKYVMSEYHFT
YALNINPKSSVLYCYAGMAKHALNDNDAALSLLSQAIALDGKNPLARYEMAAVLMSEENY
DAALAELNKLQEIAPKEASVFFLMGRIYKKLGLQEKAMINFSIALDLRPSNADVNSIKGA
IEKLDADELSDEDNI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctgagtcaagtcccggaagacggtgaagtttcgtatgaaagtggtcattac
agcgatcagcgcgatcagggtacttggagttggcagcccgcgcgaacagccgagggcgcc
gtgttggcgttcaaagagctgcgtccgctcgcggagggtctgaggcatctcgccatgtat
cgatgcgaagaagcgatccattcgtttcaacagctttcgcgatctcaatacgacaccgcc
tatgtgctgtgcgcgatggcgaaagcgcactcagagatggtggattacgccaacgcagcg
caggcgtttgaagaagcgcgcgcggccgcgccgtatcgcttggaaggtctcgatgtgtac
tcaaccgttctttggcatttgaaggaggaagtgaagctcgcacatttggcacaagaagtt
cagtctctcgatcgtctagctccagaaacgtggtgcgtgctcggaaactgtttctcgtta
caaaaggaacacgagacggctttgaaattttttcagcgcgccatccaactcgatccgaag
tgcacgtacgcgcatacgctgagcggacacgagtactttgcgaacgaagactttgaaaaa
agtatgaattgctatcgggctgcgttgagattagatgcgagacattacaacgcctggtac
ggcctcggtacggtgtattaccgccaagaaaagtacgtcatgagcgagtatcacttcaca
tacgcgctcaacatcaatccgaagtcgagcgtgttgtactgctacgccggtatggcaaag
catgcactaaacgataacgatgcagcgttatcgcttctctctcaagcgatcgcgctcgat
ggtaagaatcctctggctcgttacgaaatggccgccgtgttgatgagcgaagaaaattac
gacgccgcgttggcggagcttaacaaattgcaagagatcgcccccaaggaagcgagcgtg
ttttttctcatgggaagaatctacaaaaagcttgggcttcaagagaaagcgatgattaac
tttagcatcgcgctcgatttgcgtccatcgaacgcggacgtgaactcgatcaagggcgcc
atcgagaaactcgacgccgatgagctcagcgacgaggacaacatctga

DBGET integrated database retrieval system