KEGG   Ostreococcus lucimarinus: OSTLU_41144Help
Entry
OSTLU_41144       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 1295 aa AA seqDB search
MFLCDERHRDSARLYADDDGDDDGERQKWRTKDRMKTVSVALVLCLNIGVDPPDTMKISP
CARMQCWINPMSAQPQNELDAIGKALQAQYERWQPRAKYKLQLDPTTEDMKKLCISCRRN
AKGERVLLHYNGHGVPKPTANGEIWVFNKSYTQYIPLSVFDLQAWTGTPAIYVFDCSNAG
LIVKSFLKLSDPSAAPKITANECILIAACGANEILPQSADLPADVFSACLTTPVKMALHW
FCSNSVLRGQGISADIIDNIPGMQNNRKTPLGELNWIFTAITDTIAWNVLPRSLFQRLFR
QDLLVASLFRNFLLAERIMRANNCTPVSSPRLPPTHQHPMWAAWDMAVEQCLLQMPALLS
GNPDTEFVPSPFFTDQLTAFEVWLEYGSENDAPPEQLPIVLQVLLSQSHRLRALILLGRF
LDLGLWAVELALSVGIFPYVLKLLQTTAPELRQILVFIWTKILALDRSCQADLVKDDGHA
YFIRFLQSSNVPVEERAMAAFILAVISDGHEKGQTVCMASGLMEICLLNIPEAALPETGS
PFFLRWLCLCLGKLWEDNVEAQKAACNAQAHAMLATLFAHSSPDARAAAVYSLGSLISIG
HTLDPDLLQREDSKDDSQTQELMHAMSSTSVAINLLTTAEDASPMVRVETAVALSRIARA
HKVFMREAAIAWKRDYDTVTARRVGMSTVDEDGDRPTSSLTVENVARSADAQQGLLDSHG
ECSDGGSIPLPPTYPQSQYGDDWMQERTTEGPKGGLYTQILQVLLDLATDAAPSVSAAGI
KALMSVGLEMTHPIMEKATSTGSFAKDSSHLPALNIPRVGSRTSDLRLSPRNDSPLRRTT
STLISDHDPGYDSSGTLPRFGSHASLESLESPRIGGGSNDTSRFDHAHGDELPRSMIYKR
SCAHFSMALLESAQEEEETPDTKRRADRLRRMYERMAETRTTEEHRLKMTEYVSSIDVGG
GGVVPTSIIMHSLEPQAVAGDNRGRVHVWDHTSSRMVNKIETGLKSTDMLSLVNETDDAL
LLTGCVDGSVKIWRDYDKIGGESLVTAWNTLPSPTILPDTGSTGSLPMSLYKPSTHYNAH
ESTKAVIVWQQLTGCLYATGNAPHPLLRVWDVSSELCRETLSLQSQGTCLTAEGALLMAG
TADGAVLSYDLRAPARLLSAMQTHTQPVISILLQPGGEDNLLITGCSDGQIKFCDLRNAS
KPFLTTEVSRPSAVPNRTPSLTALVGHPCARVIASGSSERAIKLWDLQGHNFASIQYTNS
FLGQRIGSVTALSFHPNLMYLAAGSSAGHATIYSH
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgtgcgacgagcggcatcgggattcggcgaggttgtacgcggacgacgacggg
gacgatgatggggaacgacagaagtggcgcacgaaggatcgcatgaagacggtttcggtg
gctctggtgctttgcttgaacataggggtggacccgcccgatacgatgaaaatttcgccg
tgcgcgcgcatgcagtgttggatcaatccgatgagcgctcaaccgcaaaacgagttggac
gcgataggaaaggcgttgcaggcgcagtacgagcgatggcaaccgagagcgaagtataag
cttcaactcgatcccacgactgaggatatgaagaaactgtgcatatcgtgccggagaaac
gcaaagggcgagcgagttctgctccactacaacggccacggagttccgaaaccgacggct
aatggagaaatttgggttttcaacaaatcttacacgcagtacatcccgctgtcggtgttt
gatttacaggcttggactgggacgccagccatttacgtcttcgactgttccaacgccgga
ttgatcgtcaaatccttcttgaagctgtcggatccatctgccgcgccgaaaatcacagca
aacgagtgtattttaatcgccgcgtgcggtgcaaatgaaattttaccgcaatcggccgat
cttccagctgatgttttcagtgcatgcttaacgactccagtgaaaatggcgttgcattgg
ttttgctcgaattccgtccttcgagggcaaggaatctcggctgatatcatcgacaacatc
ccaggaatgcagaataatcgcaagacgccactgggcgagctgaattggattttcaccgca
atcacggatacgatcgcttggaacgttttgcctcgtagtctttttcaacgattgttcagg
caagacttactcgttgcgtcgttgttcaggaatttcttgctcgccgaacgcatcatgcgt
gcaaacaactgcacgcctgtatcatcgccgagattgccacccactcatcaacatcctatg
tgggcggcgtgggatatggccgtcgagcagtgcttgctgcaaatgccagctttactttct
ggcaatccagacactgaattcgtgccgtcgcctttcttcacagatcaactcacagcgttc
gaggtgtggttggagtacggaagcgagaacgacgcgccgcctgaacagttgccgatcgtt
ttgcaagttttactctctcagtcgcaccgtttgcgagcgttaattctgttggggcgattc
ttggatttaggattgtgggccgtcgagcttgcattatctgtcggcatcttcccttacgtg
ttaaagttgcttcagacgacggctccagagttgcgtcaaattttggttttcatatggacg
aagattcttgcgcttgatcgatcgtgtcaagccgatcttgtcaaggacgacggtcacgca
tatttcattcggttcttgcagagttcaaacgtaccggttgaagaacgcgcgatggccgct
ttcatcttggcggtcatctcagacggccatgagaagggacagacagtttgcatggctagc
ggcctgatggagatttgtttactaaatatcccggaagcggcactcccagagaccggatca
ccatttttccttcgatggttgtgtctttgcctcggaaagctgtgggaagacaatgtagag
gctcagaaagctgcgtgtaacgcacaggcgcacgcaatgctggcaaccttgttcgcgcat
tcgtcaccggatgcccgtgcagcggccgtgtactcactcggctcgctcatttctattggt
cacacgctagaccccgatttgcttcagagagaagactcaaaggacgattctcaaacgcaa
gagctcatgcacgccatgtcgtcgacgagcgtggcgatcaatttgctcacgaccgcagaa
gatgcgagtccaatggttagagtcgaaactgctgtagcgctctctcgtatcgctcgcgcg
cacaaagtcttcatgcgcgaagcggcgattgcatggaaacgcgattacgacaccgtcacg
gcgagacgtgtgggcatgtccaccgtggatgaagatggcgatcgaccgacgagctctctc
accgttgaaaatgtggcgcgctcggccgacgcacagcaaggattattggactctcacggt
gaatgtagcgatggaggttcgattccactcccgcctacgtatccgcaatcgcagtacggc
gatgattggatgcaagagcggacaactgaaggaccgaagggtgggttgtacacgcaaatc
ttacaagtgctgctcgatctcgccaccgacgcagctccgtctgtttccgcggcaggaata
aaagctctcatgagtgttggactggaaatgacgcatccaataatggaaaaagcgactagc
actgggagctttgccaaagattcgtcgcacctcccggcgttgaatattccgcgcgtagga
tcgcgaacaagcgacttgcgactttctccgaggaacgattcaccgctacgtcgaacgaca
agtacgctcatctccgatcacgacccaggttacgatagctcggggactttaccgcgtttt
ggttctcacgcgtcccttgaatcgcttgagtctcctcgaatcggtggcggatcgaatgat
acgagcagattcgatcatgctcacggcgacgagttaccgagaagtatgatttacaagcgc
agctgcgcgcacttttcgatggcattgctcgaatcggcgcaagaggaagaagagactccc
gatacgaagcgtcgtgcggacagattgagaagaatgtacgagagaatggcagagacgcga
acgacggaagaacatcgactcaaaatgacagagtatgtttcgagcattgacgtgggtgga
ggtggcgtcgtgcccacgtcgatcatcatgcactcgttagagccacaagccgtcgccggc
gacaatcgaggtcgcgtacacgtctgggaccacacttcatcgcggatggtcaacaagatt
gaaacgggcttgaaaagcaccgacatgctatccctcgtgaacgaaaccgacgatgcactc
ttactcacgggttgcgtcgatggctcggtgaaaatctggcgcgactacgataaaattggt
ggtgaatctctcgtgactgcttggaatacgctgccttcgccaaccatcttacccgacact
ggaagcaccggctccttaccgatgtccctgtacaagccgtcaacgcattacaacgcccat
gagtccacgaaggcggtgatcgtttggcagcagctgaccggatgtctttacgccacgggc
aatgcgcctcatccgttgctgcgcgtttgggacgtttcaagcgaactctgccgggagaca
ttgagccttcaatcacaaggaacgtgtttgaccgctgaaggcgctcttctcatggctggc
acagcagatggtgcagtgttgtcctacgatttgagagcgcccgcacgtttattgagcgcg
atgcaaacgcacacgcagccagtgatttcaatcctacttcaacctggaggcgaagataat
ctcctgatcactggttgctcagacgggcaaatcaagttttgcgatttgcgcaatgcatcg
aagccatttctcacgacggaagtgtcgagaccatctgcggtgcccaatcgcaccccatcg
ctcaccgcgcttgtcggacatccttgcgcccgcgtgattgcctcgggatcatctgagcgc
gccatcaagctttgggatttgcaaggtcacaatttcgcctcaattcagtacacgaactcg
ttccttgggcaacgaataggttccgtcaccgcgctctcgttccatccgaacttgatgtac
ctcgcagctggtagcagcgctggtcacgccacaatttatagtcattag

DBGET integrated database retrieval system