KEGG   Ostreococcus lucimarinus: OSTLU_42011Help
Entry
OSTLU_42011       CDS       T01029                                 

Definition
hypothetical protein
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
17
AA seq 261 aa AA seqDB search
VQVFEKLGSGGHSTVYSAKWNERQVALKIMHDESDRMTLQSEIEIMRAVNHPSIVKIYGA
CSSPMCLMLQIVHGGSLHEVLHCSTAAEAPLAETQTLRIARDISSAMTYLHELNPKIIHR
DLKPQNVLIEQDTLRALLSDFGVSRAVRTSLSPSSLGAGTVNYMAPELFDDGRADEKVDV
YSFAMILCETLSGKQPWKGIQPVRIASTILGDSEATSRPPLPPNVSEFTTELIRACWHRD
SERRPAFREILTALDRHISDA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagttttcgaaaagctaggctcgggcggtcattcgaccgtgtacagcgcgaagtgg
aacgaacggcaggtggcgctgaaaatcatgcacgacgagagcgatcgaatgacgctgcaa
agcgagatcgagatcatgcgcgccgtgaaccatccatcgatcgtcaaaatttacggcgcg
tgctcgtcaccgatgtgtctgatgttacaaatcgttcatggggggagtcttcacgaggta
ttgcactgctctaccgccgccgaagcgcctctggcggagacgcaaacgcttcgcatcgct
cgagacatctcgagcgcgatgacgtacctacacgaactcaatccaaaaatcatccatcga
gatctaaagcctcagaatgttttgatcgagcaagacacgcttcgcgcgttgctctcagac
tttggcgtatcgcgcgccgtgcgcacaagcttgtcgccgagttcgctcggcgcgggaacg
gtcaactacatggcgcccgaactcttcgacgacggtcgcgcggatgaaaaagtggacgta
tattcgtttgcgatgattctttgcgaaacgctcagcggtaagcagccctggaaagggatt
caaccggtgcgaatcgcttcgacgatcctcggcgactcggaggcgacgtctcgaccaccg
ttgccgccaaacgtctccgaattcacgaccgagctcatccgcgcgtgctggcaccgcgac
tccgagcgtcgaccggcgttccgcgaaattctcaccgcgctcgatcgacacatctcggac
gcgtga

DBGET integrated database retrieval system