KEGG   Ostreococcus lucimarinus: OSTLU_42025Help
Entry
OSTLU_42025       CDS       T01029                                 

Gene name
HAM3501
Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     OSTLU_42025 (HAM3501)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
17
AA seq 458 aa AA seqDB search
MRAPKTNAPARPDAFAAIDARAAFAVGARVRVRDGANEADGADAREGVVAARRGDGASAT
DGEVKYYVRYDATGVADEWVRVERLTSAGGESVGGSETTGGGSRSDAATAARAAAAAAAA
RKRKTTGEKDGGERGEEGGRKVRWIELGRYICDCWFDSPFPEEYTDERKLFVCDFCLKYH
RKRRAYIAHKKTCELRHPPGNEIYRHPERQATEKSPARAQLRMWEVDGSNATTYCQNLCL
IAKLFLDHKTLYYDVAAFYFYVLTERDFDESGKPLYRIIGYFSKEKGQVETNLACILTLP
PYQRRGYGGFLIEFSYELAKREGRIGTPERPLSDLGFASYRTYWSRVIYESLSSTSAGGV
NVAELSKKTNIRVDDIVSTLQPFSSIRFFKDQGFLNITKEGKQDFKAAQVKLREKWSELR
VIPERLQFEPKINAVVEVAEKRRRTRLFQRDILENNEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgccgaagacgaacgcgccggcgcgacccgacgcgttcgcggcgatcgacgcg
cgcgcggcgttcgcggtcggcgcgcgggtgcgcgtgcgggacggggcgaacgaggcggac
ggcgcggacgcgcgcgagggcgtcgtggcggcgaggcggggcgacggcgcgagcgcgacg
gacggcgaggtcaagtattacgtgcggtacgacgcgacgggggtcgcggacgagtgggtg
agggtcgaaaggttgacgagcgcgggtggggagagcgtgggagggagcgagaccacgggc
ggggggtcgagatcggacgcggcgacggcggcgagagcggcggcggcggcggcggcggcg
agaaagcggaagacgacgggagagaaggacgggggcgagcgcggcgaggagggggggcgg
aaggtgcggtggatcgagctcgggcggtacatttgcgattgctggttcgactcgccgttt
ccggaggaatacaccgacgagcgaaagctatttgtatgcgatttttgcttaaagtatcat
cggaagcggagggcgtacatcgcgcataagaagacgtgcgaactgcgacatccgccgggg
aatgagatttataggcatccagagcgacaggcgacggagaaatcgcccgcgcgcgcgcag
ttgcgcatgtgggaagtggacgggtcgaacgcgacgacgtattgtcaaaacttgtgcctc
atcgcgaaactcttcttggatcacaagacgctgtattacgacgtcgccgcgttttacttt
tatgtcttgaccgaacgggactttgacgagagtggaaagccgctctatcgaataatcggg
tacttcagcaaggagaagggtcaagtggagacgaatctggcgtgcattctcacgttgccg
ccgtaccagcgtcgcggctacggggggtttttgattgagttttcgtacgagctcgccaaa
cgcgagggacgcatcggcaccccggagcgacctctgagcgatttggggttcgcttcctat
cgaacgtactggagccgagtgatttacgaaagtctcagcagcaccagcgccggcggggtg
aacgtggcggagctgagcaaaaagacgaacattcgcgtcgacgacatcgtctcaacgcta
cagccgtttagttcgattcgattcttcaaagatcaaggcttcttgaacatcaccaaggaa
ggtaagcaggatttcaaagccgcgcaagtcaagcttcgcgaaaaatggagcgaactgcgc
gtcatacccgaacgactacagttcgagccgaaaatcaacgccgtcgtggaagtagctgag
aagcgccgccgcacgcgtttgttccaacgagacattttggaaaataatgagaaatga

DBGET integrated database retrieval system