KEGG   Ostreococcus lucimarinus: OSTLU_42710Help
Entry
OSTLU_42710       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     OSTLU_42710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 244 aa AA seqDB search
MAWRSHGVDNDSLVRALEKNAIIKSPRVANAMRAVDRGNYARHKEKEEAYYDHPLPIGYH
ATISAPHMHAACLELFEQADATRRGAKVLDVGSGSGYLAACFAELVTSEAFRNGEKDETG
EGIVVGIEHIEELVVDSLKNVERDGKGRLLETKRLMLFAGDGRNGYKPEAPYDAIHVGAS
TPSVPDALLEQLAVGGRLVIPVGDSSGQALKVIDRLEDGTFKRRTEMGVIYVPLTDRASQ
LSLF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgttcgcacggcgtggacaacgactcgctcgttcgcgcgctggaaaagaat
gcgataatcaagtcgccgcgcgtcgcgaacgcgatgcgcgcggtcgatcgcgggaactac
gcgcgacacaaggaaaaagaagaagcgtactacgatcacccgctgccgatcgggtaccac
gcgacgatatccgcgccgcacatgcacgcggcgtgcttggaactcttcgagcaagccgac
gcgacgcgacgaggcgcgaaagtgttggacgtcggctcgggctctgggtatctcgccgcg
tgcttcgcggagttggtgacgagcgaggcgtttcgaaacggggagaaggatgaaacgggc
gagggaatcgtcgtcgggatcgagcacatcgaggaattggtggtcgacagtctgaaaaac
gtcgagcgggacggtaaaggtcgattgttggagacgaaacggttgatgcttttcgcggga
gacgggcgaaatgggtacaaacccgaggctccgtatgacgcaattcacgttggagcgtcg
acgccgagtgttccggatgcgcttcttgagcaactcgccgtcggaggtcgtctcgtgatt
ccagtcggcgattcgagcgggcaggcgttgaaggtgatcgatcgactcgaagatggcacc
tttaagcggcgaacggagatgggggtgatttacgtgcccttgaccgatcgcgcgtcgcag
ctctctcttttctga

DBGET integrated database retrieval system