KEGG   Ostreococcus lucimarinus: OSTLU_42710Help
Entry
OSTLU_42710       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     OSTLU_42710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT PrmA Methyltransf_23 Methyltransf_31 Methyltransf_32 DUF938 Ubie_methyltran MTS
Motif
Other DBs
NCBI-GeneID: 5003310
NCBI-ProteinID: XP_001419071
JGI: 42710
UniProt: A4S110
Position
8:95664..96398
Genome map
AA seq 244 aa AA seqDB search
MAWRSHGVDNDSLVRALEKNAIIKSPRVANAMRAVDRGNYARHKEKEEAYYDHPLPIGYH
ATISAPHMHAACLELFEQADATRRGAKVLDVGSGSGYLAACFAELVTSEAFRNGEKDETG
EGIVVGIEHIEELVVDSLKNVERDGKGRLLETKRLMLFAGDGRNGYKPEAPYDAIHVGAS
TPSVPDALLEQLAVGGRLVIPVGDSSGQALKVIDRLEDGTFKRRTEMGVIYVPLTDRASQ
LSLF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgttcgcacggcgtggacaacgactcgctcgttcgcgcgctggaaaagaat
gcgataatcaagtcgccgcgcgtcgcgaacgcgatgcgcgcggtcgatcgcgggaactac
gcgcgacacaaggaaaaagaagaagcgtactacgatcacccgctgccgatcgggtaccac
gcgacgatatccgcgccgcacatgcacgcggcgtgcttggaactcttcgagcaagccgac
gcgacgcgacgaggcgcgaaagtgttggacgtcggctcgggctctgggtatctcgccgcg
tgcttcgcggagttggtgacgagcgaggcgtttcgaaacggggagaaggatgaaacgggc
gagggaatcgtcgtcgggatcgagcacatcgaggaattggtggtcgacagtctgaaaaac
gtcgagcgggacggtaaaggtcgattgttggagacgaaacggttgatgcttttcgcggga
gacgggcgaaatgggtacaaacccgaggctccgtatgacgcaattcacgttggagcgtcg
acgccgagtgttccggatgcgcttcttgagcaactcgccgtcggaggtcgtctcgtgatt
ccagtcggcgattcgagcgggcaggcgttgaaggtgatcgatcgactcgaagatggcacc
tttaagcggcgaacggagatgggggtgatttacgtgcccttgaccgatcgcgcgtcgcag
ctctctcttttctga

DBGET integrated database retrieval system