KEGG   Ostreococcus lucimarinus: OSTLU_4287Help
Entry
OSTLU_4287        CDS       T01029                                 

Gene name
CMK
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, putative chloroplast precursor (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) (CDPMEK) (ISPE)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
olu  Ostreococcus lucimarinus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OSTLU_4287 (CMK)
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     OSTLU_4287 (CMK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 285 aa AA seqDB search
FSPSKINLFLRITARRPDGFHDLASLFHVIDLGDDMTFAKSSSETKDTLICNDPTIPTDS
SNLVIKALDLFRAKTGVRQYFWIELDKKVPHGAGLGGGSGNAATTLFAANKLCGSPATEA
ELLEWSGEIGSDISVFFSKGAAYCTGRGEIVEDVEPPLDLATKMLLVKPPMGCSTPAIFK
ALDLDGRSKADPLELLKRIGVDGCSETVCINDLEAPAFTVLPELAELKERLKAATADKKT
VVFMSGSGSTIVIVGDDDVPAFVARDDALFKAPTRLITRKPGEWY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttctccccgtccaaaatcaacctgttcttacgaatcaccgcgcgaagacccgatggattc
cacgacctcgcgtcgctgttccacgtcatcgacctcggggacgacatgacgtttgcgaag
tcgtcgagcgagacgaaggacacgctgatctgtaacgaccccacgatcccgacggattcg
tcgaatttagtgatcaaggcgttggatttgttccgcgcgaagacgggcgtgcgacagtac
ttttggatcgagctggataaaaaggtgccgcacggcgccggactcggcggcgggagcgga
aacgcggcgacgacgctcttcgccgcgaataagttgtgtggatcgccggcgacggaggcg
gaactgttggagtggagtggggaaataggaagcgatatttcggtgttcttttctaagggc
gcggcgtattgcacggggagaggggagattgtggaggacgtggagccgccgttggattta
gccacgaagatgttgctcgtgaagccgccgatggggtgctcgacgccggctatatttaag
gcgctcgatctcgatggacgctcgaaggcggacccgttagagttgttgaaacgcatcggc
gtcgatggatgctcggagacggtgtgcatcaacgatctcgaggcgcccgcgtttacggtg
ttgcccgaactcgccgagctcaaggaacggctcaaggcggcgacggcggataaaaagacg
gtggttttcatgtctggtagcggtagcacgatcgtcatcgtcggcgacgatgacgttccc
gcgttcgtggcgcgagacgacgccctgttcaaggcgcccacgcgattaatcacgagaaag
cccggcgagtggtac

DBGET integrated database retrieval system