KEGG   Ostreococcus lucimarinus: OSTLU_4287Help
Entry
OSTLU_4287        CDS       T01029                                 

Gene name
CMK
Definition
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, putative chloroplast precursor (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) (CDPMEK) (ISPE)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00900  Terpenoid backbone biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Module
olu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OSTLU_4287 (CMK)
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     OSTLU_4287 (CMK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 5005650
NCBI-ProteinID: XP_001421612
JGI: 4287
UniProt: A4S8F9
Position
15:<261786..>262640
Genome map
AA seq 285 aa AA seqDB search
FSPSKINLFLRITARRPDGFHDLASLFHVIDLGDDMTFAKSSSETKDTLICNDPTIPTDS
SNLVIKALDLFRAKTGVRQYFWIELDKKVPHGAGLGGGSGNAATTLFAANKLCGSPATEA
ELLEWSGEIGSDISVFFSKGAAYCTGRGEIVEDVEPPLDLATKMLLVKPPMGCSTPAIFK
ALDLDGRSKADPLELLKRIGVDGCSETVCINDLEAPAFTVLPELAELKERLKAATADKKT
VVFMSGSGSTIVIVGDDDVPAFVARDDALFKAPTRLITRKPGEWY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttctccccgtccaaaatcaacctgttcttacgaatcaccgcgcgaagacccgatggattc
cacgacctcgcgtcgctgttccacgtcatcgacctcggggacgacatgacgtttgcgaag
tcgtcgagcgagacgaaggacacgctgatctgtaacgaccccacgatcccgacggattcg
tcgaatttagtgatcaaggcgttggatttgttccgcgcgaagacgggcgtgcgacagtac
ttttggatcgagctggataaaaaggtgccgcacggcgccggactcggcggcgggagcgga
aacgcggcgacgacgctcttcgccgcgaataagttgtgtggatcgccggcgacggaggcg
gaactgttggagtggagtggggaaataggaagcgatatttcggtgttcttttctaagggc
gcggcgtattgcacggggagaggggagattgtggaggacgtggagccgccgttggattta
gccacgaagatgttgctcgtgaagccgccgatggggtgctcgacgccggctatatttaag
gcgctcgatctcgatggacgctcgaaggcggacccgttagagttgttgaaacgcatcggc
gtcgatggatgctcggagacggtgtgcatcaacgatctcgaggcgcccgcgtttacggtg
ttgcccgaactcgccgagctcaaggaacggctcaaggcggcgacggcggataaaaagacg
gtggttttcatgtctggtagcggtagcacgatcgtcatcgtcggcgacgatgacgttccc
gcgttcgtggcgcgagacgacgccctgttcaaggcgcccacgcgattaatcacgagaaag
cccggcgagtggtac

DBGET integrated database retrieval system