KEGG   Ostreococcus lucimarinus: OSTLU_4352Help
Entry
OSTLU_4352        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
olu  Ostreococcus lucimarinus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:olu03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 277 aa AA seqDB search
MPELPEVEKARRLVHDLAIGSPISRVHRPIIDDKVFVDVASGQFERALSGRKITHSKRHG
KQLWWQLDGNDALVPCFHFGMTGAFVARGIDGIQYYNSKASGTGDWPPRFAKLVVAFENG
VELAFVDPRRFGKIKLVADVAEVIGQLGPDPLLEMPNEEAFAALWRRRSAPIKTAIMDQK
VIAGIGNWMADEILYRARVHPETRANELSSTQLEAIRFRVTEVVKVACEANSDHDLFPDD
WLFHHRWGKTGGAKVNGDAIKFIEVGGRTTAFVPKLQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttcccgaggtcgaaaaagctcgtcgcctggtgcacgacctcgcgatcgga
tccccgatctcgcgcgtccatcgacccatcatcgacgacaaagtttttgtcgacgtcgca
tcgggacagtttgagcgcgcgctctcgggacggaaaatcacccacagtaagcgccacggt
aagcagttgtggtggcagctcgacgggaacgacgcgctcgttccgtgctttcacttcggg
atgacgggggcgttcgtggcgcgaggaatcgatgggattcagtattacaatagcaaggcg
agcggaacgggcgactggccgccgcggttcgccaagctcgtcgtcgcgttcgagaacggc
gtcgagctcgcgttcgtagacccgagaaggtttggaaagatcaaactcgtcgcggacgtc
gcggaggtgatcggccaactcgggccggatccgctgttggagatgccgaacgaggaggcg
ttcgcggcgctatggcgacgaaggagcgcgccgataaagacggccatcatggaccagaag
gtgatcgctgggatagggaattggatggcggacgaaattttataccgagcgcgagtgcat
ccggagactcgagcgaacgagttgagctcgacgcagctcgaagcgattagatttcgcgtc
acagaagtcgtcaaagtagcgtgcgaggcaaactctgaccacgatttgtttccagacgac
tggttgttccaccatcgctgggggaaaaccggcggagcgaaagtcaacggagacgcgatt
aagttcatcgaagtcggcggtcgcaccaccgccttcgtgcccaaacttcag

DBGET integrated database retrieval system