KEGG   Ostreococcus lucimarinus: OSTLU_4354Help
Entry
OSTLU_4354        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     OSTLU_4354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 243 aa AA seqDB search
DADFGPTLVRLAWHSSGTYDRMGKTGGSGGGTIRFKEELAHGGNAGLDKAIAKLEPIKKR
HPDVSWADLIAFVGVVAIEEMGGPKLKFSYGRVDEMDPEAVTPDGRLPDADKGDGPGPKT
RQGLRDVFYRMGFDDREIVALSGAHALGRCHADASGYVGPWSGTPLLFNNSYFVLLKGLK
WEPNPDAKKFQYKDPSGNLMMLPSDIALIEDADFKKYVDVYAKSQKVFFEDFAAAFEKLE
TLG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gacgcggacttcgggccgacgctcgtgcgactcgcgtggcactcgtccgggacgtacgac
cggatgggcaagactggtgggagcggcggcgggacgattcggtttaaagaggaactcgcg
cacggcgggaacgcgggactggataaggcgatcgcgaagctcgagccgatcaagaagcgg
cacccggacgtatcgtgggccgatctcatcgcgttcgtcggcgtcgtggcgatcgaagag
atgggcgggccgaagttgaagttttcgtacggtcgcgtcgacgagatggatcccgaggcg
gtcacccccgacgggcgcttgcccgacgccgacaagggcgacggccctggaccgaagacg
aggcaaggcttgcgcgacgtcttctaccgcatgggtttcgacgatcgagaaatcgtcgcg
ttgagcggcgcccacgccctcggtcgttgtcacgccgacgcgtccggttacgtcggaccg
tggagcgggacgccgttgctgttcaacaactcctacttcgtcctcctcaaaggcttgaag
tgggagccgaatccggacgccaaaaagttccaatacaaagacccgagcggcaacttgatg
atgcttccgagcgacatcgcgctcatcgaagacgccgacttcaagaagtacgtcgacgtc
tacgccaagagtcagaaggttttcttcgaagacttcgccgccgcgttcgaaaagctcgag
acgctcggc

DBGET integrated database retrieval system