KEGG   Ostreococcus lucimarinus: OSTLU_43602Help
Entry
OSTLU_43602       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OSTLU_43602
   01230 Biosynthesis of amino acids
    OSTLU_43602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_43602
   00051 Fructose and mannose metabolism
    OSTLU_43602
   00562 Inositol phosphate metabolism
    OSTLU_43602
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_43602
Enzymes [BR:olu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OSTLU_43602
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OSTLU_43602
  Exosomal proteins of bladder cancer cells
   OSTLU_43602
  Exosomal proteins of melanoma cells
   OSTLU_43602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 338 aa AA seqDB search
MTRVATPTRVATPARDATKRTTRCRWLTRPRDDDARRRVATNAGNGRFIVGGNWKCNGTR
ASVKTLIEELNAGELRDVDVVVAPPFLFLDEATETLKAPYEVAAQNCWVEPGLVDPTHHY
DSDTGAFTGEVSAEMLEDLRIPWVILGHSERRNLFNESNEFVGKKVAHARFHGLSVIVCV
GETLEERESGKTMDVIFAQLKAVATEIDDKEHSSWGSQVVIAYEPIWAIGTGKVATPEQV
QDVHAKIRQWLADNVSEEVAKATRIQYGGSVNAGNCSELARLSDIDGFLVGGASLKGDDF
VKICNTSAVHYKAIGRKPRSGSVVTYSFDEDGELLETK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgtcgcgacgccgacgcgcgtcgcgacgccggcgcgcgacgcgacgaaacga
acgacgcgatgccgatggctgacgcgaccgcgcgacgacgacgcgcgacgacgcgtcgcg
acgaacgcggggaacggacggttcatcgtgggaggaaattggaagtgtaacggcacgcgc
gcgtcggtgaagacgctgatcgaggagctgaacgcgggagagctgagggacgtggacgtc
gtcgtggcgccgccgtttttgttcttggacgaggcgacggagacgttgaaggcgccgtac
gaggtcgcggcgcagaattgctgggtcgagccgggtttggtggatccgacgcatcattac
gatagcgatacgggggcgttcacgggggaggtgagcgcggagatgttggaggatttacga
attccttgggtgattctcgggcacagcgaacggagaaatctcttcaacgaatcgaacgag
ttcgtggggaagaaggtggcgcacgcgcggtttcacggcttgtccgtgatcgtgtgcgtc
ggagaaacgctggaggagcgagagagcggaaagacgatggatgtgattttcgctcagctc
aaagccgtggcgacggagatcgacgacaaggagcactccagctggggatcgcaagtcgtc
atcgcgtacgagccgatttgggcgatcgggactggcaaggtggccacgcccgagcaagtt
caagacgtgcacgcgaagattcgtcagtggctggcggataacgtcagcgaagaggtggcc
aaggcgacgcgcattcagtacggggggtcggtcaacgccggcaactgctccgaattggct
cgtctgagcgatatcgacgggttcttggtcggcggcgcgtcgctcaagggtgacgatttc
gtgaagatttgcaacacgagcgcggtgcactacaaggcaatcggacgcaagcccagatct
ggctcggtcgtgacgtactcgttcgacgaagacggcgagctcctcgagacgaagtaa

DBGET integrated database retrieval system