KEGG   Ostreococcus lucimarinus: OSTLU_43800Help
Entry
OSTLU_43800       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06443  
lycopene beta-cyclase [EC:5.5.1.19]
Organism
olu  Ostreococcus lucimarinus
Pathway
Carotenoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    OSTLU_43800
Enzymes [BR:olu01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.19  lycopene beta-cyclase
     OSTLU_43800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 528 aa AA seqDB search
MRARRAPAARVTRAIRARGDAGTRARDVAPGATRRGASATPRATRRPSARETRPELYGLD
ASWDPLTSGDRRESEESRTPLPETLPNVRWGTSASEAYDLVIVGCGPAGLTAADEASKRG
LRVALMDPSPLAPWMNNYGVWCDEFKSLGFDDCYRAVWNKARVIIDDGDADGKMLDRAYA
QVDRKKLKQKLIARSVTQGVEFGIAAVDSCDNSDPNHSVVTLSDGRKVYAKMVLDATGHS
RKLVDFDRDFTPGYQAAFGIVCTVEKHDFPLDTMLFMDWRDEHLSPEFKRANDRLPTFLY
AMPFSETEVFLEETSLVARPGLEFDDLKLKLKERLDYLGVKVTKVHEEEYCLIPMGGVLP
TFPQRTLGIGGTAGMVHPSTGFMVAKTMLCVRTLVGTLDEALKAGKRGDITGALEAAEAA
QMNNGKFDADATAALVWNSIWPENDLRMRTFMCFGMETLMQLDIDGTRQFFDTFFDLPKD
VWAGFLSWRIQPVGLLSLGVNLFALFSNYMRVNFVKSALPFMGSFFAN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgcgtcgagcgcccgcggcgcgcgtgacgcgcgcgattcgcgcgcgaggcgac
gcgggaacgcgcgcgcgcgacgtcgcgccgggcgcgacgcggcgcggggcgtcggcgacg
ccgcgggcgacgcgacggccgagcgcgagggagacgcggccggagctgtacggcttggac
gcctcgtgggacccgctgacgagcggcgatcggcgggagagcgaggagtcgcgaacgccg
cttccagaaacgctgccgaacgtgcgatgggggacgagcgcgagcgaggcgtacgatttg
gtgattgtcgggtgcggaccggcggggctgacggcggcggacgaggcgagcaagcgcgga
ttgcgcgtggcgttgatggatccgtcgccgctcgcgccgtggatgaataattacggggtg
tggtgcgacgagtttaaatcgctcgggttcgatgattgctatcgcgcggtgtggaacaag
gcgcgagttattatagacgacggcgacgccgacgggaagatgctcgaccgcgcgtacgcg
caggtggatcggaagaagctcaagcagaagctcatcgcgcgcagcgtgacgcagggcgtg
gagtttggtatcgccgcggtcgatagctgcgataacagcgatccgaaccattcggtggtg
actttgagcgatggacgcaaggtctatgcgaagatggttttggacgccactgggcactct
cgtaagctggtggactttgatcgcgattttacgccgggatatcaagccgctttcggaatc
gtgtgcacagtggagaagcacgactttccgttggacacgatgctgttcatggactggcga
gacgagcacttgagcccagagtttaagcgagcgaacgacaggttgccgacgtttttgtac
gccatgcctttctcggaaactgaggtgttcctcgaggaaacgagcttggtggcacgacct
ggcttagagtttgacgacttgaagctcaagttgaaggagcgtttggattatttgggcgtg
aaagtaaccaaggtacacgaagaggagtattgtctcattcccatgggcggcgtgttgccg
acgtttccgcaacgcacgctcggcatcggtggaaccgccggcatggtccatcctagcact
ggatttatggtcgcaaagacgatgttatgcgttagaacgctcgtaggcacgcttgatgaa
gcccttaaggcgggtaagcgaggggatattaccggcgccctggaagcggcggaggcggcg
caaatgaacaacggtaaattcgacgccgacgccaccgcggcattagtgtggaactcaatt
tggccggagaatgatttgcgcatgcgcactttcatgtgctttggaatggagactcttatg
cagctcgatatcgatggaacgcgtcaattctttgacacgttcttcgaccttcccaaggac
gtctgggctggctttttgagctggcgaatccagccggtgggcttgctttcgctcggggtg
aatctgttcgcgttgttttcgaactacatgcgagttaactttgtcaaatccgctctgcct
ttcatggggtcgttcttcgcaaac

DBGET integrated database retrieval system