KEGG   Ostreococcus lucimarinus: OSTLU_44507Help
Entry
OSTLU_44507       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     OSTLU_44507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 563 aa AA seqDB search
MHAEDALVAETGCCVFLQSTYGDGEPTDTSSDFVYWARDCASDGRMPDLLENVTFSVFGL
GNRCYEQFNAAAKMVHKALVDLGAQPLLKLHLGDDDQCLEQDFENWIEAFWPAFEAKFGL
HSDGGDEELPRYDVIIMRGSDGERAAASQAAKYEKEHSNTRVAPTAAKPYLSSVKVVREL
FSKDADRSCVHVEFDISGSSVQYKTGDHLGVFAENGKDVTKRVAKALKLDVDEVFRLVKP
SGAPASLAEPFATPMTVGDAIARYADVLTPPRKQALAALASVASGKDAEKLAFLASPAGK
DEFAKYITKPHRSLLEVMEDYSSAVPDIGLFFGAVAPRLAARFYSISSSPAANKNVVTAT
VAVVKEKVFTGRMHEGVASTFLQRAAEGQKIPIFVRTSTFRLPTNPEAPVIMIGPGTGYA
PFRGFLQERTALQASGAKLGPAMLFFGCRNKDRDFIYEAEMQTALREGVITDLDVAFSRD
GPKKVYVQDKIIEKASTVYPIVKGTVGKNEGAVFICGDAKNMAKDVNKALLSVLMREGDY
AAHEAEEILRRLKAEFRYHQDVW
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccgaggacgcgctcgtggcggagaccgggtgctgtgtgtttctgcaatcgacg
tacggggacggggaaccgacggatacgagctcggatttcgtgtattgggcgcgggactgc
gcgagcgacgggcggatgccggatttgttggaaaacgtaacgttcagcgtgttcgggctc
ggtaatcgttgctacgaacagttcaacgcggcggcgaagatggttcacaaggctttggtg
gatttaggcgctcaaccgctgctgaagcttcacttgggagacgacgaccagtgcttggag
caagactttgaaaattggatcgaggcgttttggcccgcgttcgaggccaagtttggttta
cattccgacggcggcgacgaggagttgcctcgttacgacgtcatcattatgcgtggtagc
gacggcgagcgcgcagcggcgagtcaggcggccaaatacgaaaaggagcactctaacacg
cgcgtcgcgccgacggcggcaaagccgtacctctcctccgtcaaagttgtgcgcgaactc
ttcagtaaagatgccgatcgaagttgcgttcacgtagagtttgatatttcaggctcgagc
gtgcagtacaagacgggcgaccacttgggcgtgtttgcggagaacggtaaggacgtcacg
aagcgcgtagccaaagcgctgaagctcgacgtcgacgaggtcttccgtttggtgaagccg
agtggtgctcctgcgtcgctcgccgagccgttcgcgacgcccatgacggtcggagatgcg
attgcgcggtacgcggacgttttaacgccccctcgaaagcaagcgctcgctgcgctcgcc
tccgtcgcttcgggcaaggacgcagaaaagctcgcctttttagcctcgccggcgggcaag
gatgaattcgcaaagtacataacgaagccccacagatcgcttttggaggtgatggaggac
tactccagcgctgttccagatattggattattctttggcgccgttgcgcctcgtttagcg
gctcgattttacagcatcagctcaagtccggcggctaacaaaaacgtcgtcaccgccacc
gtcgccgtcgtcaaagagaaagtcttcaccggtcgcatgcacgaaggtgtcgcgagtaca
ttcttacagcgcgcggctgaaggccaaaagattccgattttcgtgcgaacgagcactttc
cgactgccgacaaatccagaagcgcctgttatcatgattggaccaggcaccggctacgcc
cctttccgaggtttcttgcaagagcgcacggcgcttcaagcttctggtgccaagttaggc
ccggcgatgctgttctttggatgccgtaacaaagatcgcgatttcatatacgaagcagag
atgcagaccgcgttgcgagagggcgtgattaccgacctggacgtggcgtttagccgcgac
gggccgaagaaggtgtacgtgcaggacaagattatcgaaaaggcgtcgacggtgtaccca
atcgtcaaaggtaccgtgggcaaaaacgagggcgcggtgttcatttgcggtgacgcgaag
aacatggcaaaggatgtgaacaaggcgctcctgagtgtgttgatgcgcgagggcgactac
gcggcgcacgaagcggaggagattttacgtcgcctgaaggcagagtttagataccatcag
gacgtgtgg

DBGET integrated database retrieval system