KEGG   Ostreococcus lucimarinus: OSTLU_44757Help
Entry
OSTLU_44757       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OSTLU_44757
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_44757
   00620 Pyruvate metabolism
    OSTLU_44757
   00640 Propanoate metabolism
    OSTLU_44757
Enzymes [BR:olu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OSTLU_44757
Lipid biosynthesis proteins [BR:olu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OSTLU_44757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 644 aa AA seqDB search
MDTLRNCSSRGQYDELYRESVTEPEKFWSKLAKDFVWSADWSDSVSAFNFNTDVGKVDVS
WFAGGKTNIAWNCIERNIERGCGEQVALIWEGNDVGEEGTKTYSELQADVNRLANWLKSV
GVAKGDAVVLYLPMIMELPIAMLACARIGAVHSVVFAGFSSEALAQRLLGSAAKVVLTCS
AVMRGSKHINLKAVVDEACDSSAEKGHKIEHCLCFMNERLDVEGFLTTSRDEHWQQAVHA
QSMECTTEWVDAEHPLFMLYTSGSTGSPKGVLHTTGGYMVYAGATCASVFNMQQGDIFWC
TADCGWITGHTYVTYGPLLNGAASVVFEGVPTHPDAGRCWQIVDKYNVKAFYTAPTAIRA
LQRYGNDFVLKHQRLSLKILGTVGEPINPEAWQWYSEIVGGGRCPIVDTWWQTETGGHMI
TPLPFAIEQKPGSATLPFFGVQPVLLNDAGEELTGEAEGYLCFKKPWPSMFRTLFSDHKR
YEEAYFSMFKGYYFSGDGAKRDSDGYYWITGRVDDVINVSGHRIGTAEVESALVTHQECT
EAAVVGIDHAIKGQSIYAFVTLREGCVLTEATKKALVNCVRTVIGPFAAPDTIQWAPGLP
KTRSGKIMRRILRKIASREEDSLGDISTLADPSVVDALVKERSQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggatacacttcgaaactgttcgagtcgtggccagtacgacgagctctatcgcgaatcc
gttactgagccagagaaattttggtccaaactggccaaggacttcgtctggagtgctgac
tggtctgatagtgtgagcgccttcaacttcaataccgacgtcggaaaagttgacgtctca
tggtttgccggcgggaagaccaacattgcgtggaattgcatcgaacgaaatattgaaagg
ggctgtggagagcaggtcgcgttaatctgggaaggtaatgacgtcggtgaagaagggaca
aaaacgtacagtgagctccaagcagatgtcaatcggctggcaaactggctgaaatcggtc
ggagttgctaagggtgatgctgttgtactgtacttacctatgattatggaacttcctatt
gcgatgcttgcttgtgcccgcatcggggctgtccactctgttgtgtttgcaggattttct
tctgaggcgttagcgcagcgtcttctgggatcggcggcgaaagtggtgttaacatgttca
gctgtgatgagaggttcgaaacacataaatttaaaagctgtcgtcgacgaagcatgtgat
tccagtgccgaaaagggtcataaaattgaacactgcttatgtttcatgaacgagaggctt
gacgtggagggctttctcacaactagtcgtgatgaacattggcagcaagcagtacatgca
caatccatggagtgcacaacagaatgggttgatgcggagcatccactcttcatgttgtac
acgtctggttctacaggctccccgaagggcgtcctccatactaccggagggtacatggtt
tatgctggagctacatgcgcctctgttttcaacatgcaacaaggtgatatattttggtgc
actgcagattgtggctggataacaggtcatacgtacgtgacatatggaccacttctaaac
ggtgccgcttcagttgtctttgagggagtaccgacacatccagatgctggtcggtgttgg
caaatcgtggacaaatataatgtgaaagcattctacacagcgccaactgcgataagagcg
ttgcagcgatacggtaacgactttgttctcaaacaccaaaggctgtcgctgaaaatattg
ggtacagtcggagaaccgattaaccccgaagcatggcagtggtactccgagatcgtcgga
ggtggacgctgtccgatcgtagacacctggtggcaaacggaaaccggtgggcatatgatc
actccactgccttttgcgatagagcagaagccaggttcggcgactctcccgttctttggt
gttcaaccagtattactgaacgatgccggagaagaattgacaggagaggccgaagggtat
ttgtgtttcaagaaaccgtggccatccatgtttcgaacacttttttcggatcataaaagg
tacgaagaagcgtacttctccatgtttaaagggtactacttttcaggcgatggggccaag
cgtgactcggatgggtattattggattaccggacgtgttgacgatgtcatcaacgtgtct
ggtcatcgtatcggcactgcggaggtcgagtcggcattagtcacccatcaggagtgtact
gaagccgctgtagtgggaattgatcacgctatcaagggtcagtcgatatacgcttttgta
acgttgcgcgaaggttgtgttctcacggaggcaacgaagaaagctctggtgaactgtgtg
aggactgttatcggtccgttcgcagcacctgatactattcaatgggcgccaggattacca
aaaacgcgtagtggtaaaattatgagacgcatcttgaggaaaatagcgtctcgagaagaa
gactcgttgggtgacatatccactctagctgatcctagcgttgtggatgcccttgtgaaa
gagcgaagtcaatag

DBGET integrated database retrieval system