KEGG   Ostreococcus lucimarinus: OSTLU_45076Help
Entry
OSTLU_45076       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
olu  Ostreococcus lucimarinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OSTLU_45076
Enzymes [BR:olu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OSTLU_45076
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_45076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 710 aa AA seqDB search
MPPIEGDGFAVCALDSMLEHHKGHLGHRFEKFKNLRQAIEDHEGGIEKFSRGYEKMGFTR
TAEGITYREWAPNASAACLRGDFNGWDLGENGKWMTKNDYGVFEVFLPNNADGSPAIPHG
SRVKIHLQIPNGEPVDRIPAWIKYAVQAQGEIPFNGIYYDPPEEEQYKFKYERPDAPEEL
RIYEAHVGMSSTEPKINSYVEFADDVLPRIKDLGYNAVQLMAVQEHAYYASFGYHVTNFF
GVSSRCGTPDELKYLVDKAHSMGLTVLMDLVHSHASSNSIDGINMFDGSNGQYFHSGPEG
YHWMWDSRCFNYGEWEVVRYLLSNLRYWIEEFKFDGFRFDGVTSMMYKHHGLQVAFTGNY
EEYFGMATDVDAMVYLMLANDMLHTLYEGKMTTIAEDVSGMPTLCRPVSEGGVGFDYRLQ
MAIADKWIEVLSEWGSDENWDMGNLVFTMENRRYGEKCISYAESHDQALVGDKTTAFWLM
DAEMYTNMSTLVPDSPVVSRGIALHKMIRQFTMGLGGEGYLNFMGNEFGHPEWIDFPRDD
RVEASTGEFIPGNGNSYHLCRRRFDLADMDHLRYKYLNAFDAQMNKVAGAFKYLASSHQY
TSCKSDADKVVVFERGDLVFVFNWNPTQSFSDYRIGCKEKTNYKLVLSSDNPEFGGYSNL
WTYTAPEFVAEDYAFNGRPASFLAYLPSRTVAVYAPADLADKVLGFAAPA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgattgagggcgatggtttcgccgtctgcgcgctcgactcgatgttggaacac
cacaagggacacctcggtcatcgtttcgaaaagttcaagaacttgcgccaagcgatcgaa
gatcacgaaggtggcatcgaaaagttcagccgaggctatgaaaagatgggtttcacgcgc
accgcggagggcattacttacagagagtgggcgccgaacgcgtcggccgcgtgccttcgc
ggcgacttcaacggttgggatctcggcgagaatggcaagtggatgaccaagaacgattac
ggcgtgttcgaagtgttccttccgaacaacgcggacggttctccggccatcccgcacggc
tctcgcgtgaagattcatcttcaaattcccaacggcgaacccgtcgaccgcatcccggct
tggatcaagtacgcggtgcaggcgcaaggcgaaattccgttcaacggcatctactacgat
cccccggaagaagagcagtacaagttcaagtacgagcgaccggatgcccccgaagagctt
cgcatttacgaagcgcacgtcgggatgtcttccaccgagccgaagatcaactcttacgtc
gagttcgccgacgatgtcttgccgcgcatcaaagacctcggttacaacgccgtacaattg
atggctgttcaagagcacgcgtactacgcatctttcggctaccacgtcaccaatttcttc
ggcgtgtcttctcgatgcggtacgcccgatgaattgaagtacttggtcgacaaggcgcac
tccatgggcctcaccgtgctcatggatttggtgcactctcacgcgtcgtccaactccatc
gacggcatcaacatgttcgacggtagcaacggtcagtacttccactctggtccggaaggt
tatcattggatgtgggattcccgatgcttcaactacggcgaatgggaagtcgtgcgctac
ttgctctcgaaccttcgctactggatcgaagaattcaagtttgatggtttccgtttcgat
ggcgtgacgtccatgatgtacaagcatcacggtcttcaagtcgccttcacgggtaactat
gaagagtactttggcatggccactgacgtcgacgccatggtgtacctcatgctcgccaac
gacatgcttcacactctctacgaaggcaagatgacgacgatcgcggaagacgtgagcggc
atgccgacgctttgccgcccggtcagcgaaggcggtgtcggtttcgactatcgcctccaa
atggccatcgcggacaagtggatcgaggtcttgagcgagtggggttcggatgaaaactgg
gacatgggtaacttggtgttcaccatggagaaccgtcgctacggcgaaaagtgcatctct
tacgccgaatctcacgatcaagcgctcgttggcgataagactaccgctttctggttgatg
gatgcagaaatgtacaccaacatgtccacgctggtacccgacagccccgtcgtgtcgcgc
ggcattgccttgcacaagatgattcgccaattcacgatgggtctcggtggcgaaggttac
ttgaactttatgggtaacgaattcggccacccggagtggatcgatttcccgcgcgatgat
cgcgtcgaggcgtcgacgggtgaattcatcccgggtaacggcaactcgtaccatttgtgc
cgccgacgattcgacttggccgacatggaccacttgcgctacaagtacctcaacgcgttc
gacgcgcagatgaacaaggtcgccggcgctttcaagtacctcgcgtctagccaccagtac
acgtcgtgcaagagcgacgcggataaagttgtcgtgttcgagcgcggtgacttggtgttt
gtgttcaactggaacccgacgcagtcgtttagcgactaccgcatcggatgcaaggaaaag
acgaattacaagctcgtgctgagctcggacaaccccgaatttggtggttactccaacttg
tggacgtacacggcgcccgaatttgtcgccgaagattacgccttcaacggtcgcccggcc
tcgttcttggcgtacttgccctcgcgcaccgtcgccgtgtacgctccggccgacttggcg
gacaaggttctcggcttcgcggctccggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system