KEGG   Ostreococcus lucimarinus: OSTLU_45116Help
Entry
OSTLU_45116       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00250  Alanine, aspartate and glutamate metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OSTLU_45116
Enzymes [BR:olu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     OSTLU_45116
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C44
   OSTLU_45116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 DUF1933 tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 5000791
NCBI-ProteinID: XP_001416881
JGI: 45116
UniProt: A4RU16
Position
3:complement(236844..238760)
Genome map
AA seq 638 aa AA seqDB search
MCGIFSVLRLTGDARKNRQRVYQLAKRLRHRGPDSYGMEVRLDDAGRQTFMVHKRLSIVA
PGKSGDQPLFTDATKRTAFIANGEIYNHAELREKYGIVSENKSDCQVIGHLYEQHGPSFV
SELDGMFAFVIEDRENDVIVAARDHMGKIPMYMANGKDGSVWFSSEMKTLHDDPGVANYE
IFPPGHVYVKKGDAPATIERWYNPQWITDENYVPTKEANLEELRECVVDAVTKRLMADVP
YAVLLSGGLDSSLITSIAVRQRKLAKNTYGADEPVHSFSIGIKGAPDLVAARKVAEQLGT
IHHEVHFTPEEALDALPDVIWHLETFEQVRASVPMYLLSRHIKSLGFKMVLSGEGADELF
GGYLYFHKAPNPAEFHAECRRKTMRLHQWDVLRANKSTMSWGIEVRTPLLSQQVIDLAMN
MRPEDKMIDVNKKDADGRPYLEKYILRKAFDTPGDSYLPQEVLWRQKEQFSDGVGYDWVD
GLAAHAELEVSDEDFARRAQRFPLHPPTTKEYYLLRSIFEEHFVTGFENGDCAYATCPFG
KSIACSTPEAVCWDPEWEKSVGDISGRAVKNVHVAADKFDVKKDGTAATISATMTGVRER
GVRVKARAVRGVPQQQARRGHVRFSGLRASPASKVLLL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcttcagcgtcctgcgcctcacgggcgacgcgcgcaagaatcggcagcgc
gtgtatcagctcgcgaagcggctgcgacaccgaggaccggattcgtacgggatggaggtg
cgattggacgacgcgggacgacaaaccttcatggtgcacaagcgcctgagcatcgtggcg
ccgggaaagagcggcgatcaaccgctgttcacggacgcgacgaagaggacggcgttcatc
gcgaacggggagatttataatcacgcggaattgagggaaaagtatggaatcgtgagcgag
aataagagcgattgtcaagtcatcgggcacctgtacgagcagcacgggccgagctttgtg
agcgagctcgacggaatgttcgcgttcgtgattgaggatcgcgagaacgatgtgatcgtg
gcggcgagagatcacatgggtaagattccgatgtatatggcgaacgggaaggatgggagc
gtgtggtttagcagcgagatgaagacacttcacgacgacccgggggtggcgaattatgaa
atcttcccccctggtcacgtgtacgtcaagaagggggacgcgccggcgacgatcgagcgc
tggtacaacccgcagtggattacggatgaaaattacgtgccgaccaaggaggcaaacttg
gaggagctccgtgagtgcgtcgtcgacgccgtcaccaagcgtttgatggcggacgtcccg
tacgccgtgctcctctctggaggcctcgactcttcgttgatcacttccatcgctgtgcgt
cagcgtaagttagcgaagaacacgtacggtgcggacgaacccgtgcactcgttttccatc
ggtatcaagggggcaccagatttagtcgccgctcgcaaggttgccgagcaactcggaacg
attcaccacgaggtgcatttcacgcctgaggaagccttggacgcgcttccggatgtcatt
tggcatctggaaacgttcgaacaagttcgggcgtcggtgccaatgtatcttttgagccgt
catatcaagtcactgggattcaagatggtgctgtcgggcgagggcgcggatgagctcttc
ggcggatacttgtattttcacaaggcgccgaacccggctgaattccacgccgagtgccgt
cggaagaccatgcgattgcaccaatgggacgttttgcgcgcgaacaaatcaactatgagt
tggggcattgaggtgcgcactccgctcttgtctcagcaagtcatcgatctcgcgatgaac
atgcgaccggaggacaagatgattgatgtcaacaagaaggatgcggatgggcgtccgtac
ttggaaaagtacatccttcgcaaggcgttcgacacccctggagattcctacttgccgcaa
gaagtgctttggcgacaaaaagaacaatttagcgacggcgtcggctacgactgggtcgac
ggtttggcggcgcatgccgagctcgaagtgtcggatgaagactttgcgagacgcgcccaa
cgcttcccgctgcatccgccgacgacgaaggagtattacttgctccgctccattttcgag
gagcactttgtgactggatttgagaatggtgactgcgcgtatgcgacgtgcccatttggc
aaatctatcgcgtgttccactccggaagccgtgtgctgggatcctgagtgggagaagagc
gtcggggatatttctggccgggcggtgaagaacgtgcacgtcgcggcggataagtttgat
gtgaagaaggatgggacagccgcgactatctctgcgactatgacgggtgttcgggagcgt
ggtgttcgtgtcaaggcgcgcgcggtgcgtggcgtcccgcaacagcaagcgcgtcgcggg
catgtccggttctccggtttgcgcgcctctcccgcctccaaggttttacttttgtag

DBGET integrated database retrieval system