KEGG   Ostreococcus lucimarinus: OSTLU_45141Help
Entry
OSTLU_45141       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OSTLU_45141
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OSTLU_45141
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OSTLU_45141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 522 aa AA seqDB search
MARRRATCVGALDQGTTSTRFVVYETTAPRDARTYVKIASAQREHAQRYPAPGWCEHDAE
EIFERALTCAREALRSAGVTASDLACVGITNQRETTCAWRRSDGTALANAVVWLDSRTRE
TCDAVVREACDGDKNAFVATCGLPVSTYFSAMKMRWLLENDEGVREAAREKDLCFGTIES
WLVYKLTGGKAHITDVSNASRTLLMRLDDLTWDAATCETLGVPMDALPEIKSCAEDFGEI
DASIEGLGGIKITGCIGDQQSATLGQRCDVGQAKNTYGTGCFMILNTGSTIVRSKHGLLT
TMAWQLGGRDKTPKYALEGSVAIAGAVVHWLRDNLGLIKTASDIESLAGTVEDAAGVSFV
PAFSGLFAPRWREDARGVIVGLTQYVNKGHIARAALDAIAFQSRDVLDAMRQDMAESTSH
SLSALKVDGGASANNLLMQIQADCIGLNVIRPSDVETTARGAAYAAAIGAGLMTEEDVFA
NVSEGDGDRDITEFVPKLSIEARETNYARWNDAVERTLNLSA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtcggcgcgcgacgtgcgtcggcgcgctggatcaggggacgacgtccacgcgg
ttcgtcgtgtacgagacgacggcgccgcgggacgcgaggacgtacgtgaagatcgcgtcg
gcgcagcgggagcacgcgcaacggtatccggcgccgggatggtgcgagcacgacgcggag
gagatctttgagcgcgcgctgacgtgcgcgagggaggcgctgcgatcggcgggcgtgacg
gcgagcgatctggcgtgcgtggggatcacgaatcagcgagagacgacgtgcgcgtggcgg
cgaagcgacgggacggcgctggcgaacgcggtggtgtggttggactcgcgcacgcgggag
acgtgcgatgcggtggtgagagaggcgtgcgatggggataagaacgcgttcgtcgcgacg
tgtgggttgccggtgagcacgtattttagcgcgatgaagatgcggtggttgttggaaaac
gacgagggcgtgcgcgaggcggcgcgcgaaaaagatttgtgctttggaacgatcgagagt
tggttggtgtataaactcaccggcgggaaagcgcacattacggatgtttcgaacgcgtcg
cgaacgctgctgatgcgattggatgatttgacgtgggacgcggcgacgtgcgagacgctc
ggcgtgccgatggacgcgctgccggagatcaaatcgtgcgccgaggattttggcgagatc
gatgcgagcatcgagggtttaggagggatcaaaattacgggatgcatcggtgatcagcaa
tcggccacgctcggacagagatgcgacgttggtcaggcgaagaatacgtacggcaccggt
tgcttcatgattctcaatacgggttcaaccatcgtgcgctcgaagcacgggctgctcacg
actatggcgtggcagctcggaggacgagacaaaaccccaaagtatgctttggagggttct
gtcgcaatcgcgggcgcggtcgtgcactggttacgcgataatctcgggttgattaaaacg
gcgagcgatatcgaaagtctcgccggcaccgtggaagatgccgctggtgtatcgtttgtc
cccgcatttagcggtctttttgcgccaagatggcgcgaagacgcgcgtggtgtgattgtg
gggctgacgcagtacgtcaacaaaggacacatcgcgcgagccgcgctagacgccatcgcg
tttcaatcgagagacgttctcgacgccatgcgtcaagacatggctgaatcgacctcgcat
tcgctgagtgcgcttaaagttgacggcggcgcgagtgcaaataatcttctcatgcaaatt
caagccgattgcatcggtttgaatgtcattcgtccctcggatgtggagacgacggctcga
ggcgcggcgtacgccgcagccatcggcgccgggttgatgacagaggaagacgttttcgcg
aacgtcagcgaaggtgatggtgatcgggacatcacagagttcgtcccgaaactatccatc
gaagctcgcgaaacgaactacgcgcgttggaacgacgccgttgaacgcacgctcaacttg
agtgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system