KEGG   Ostreococcus lucimarinus: OSTLU_45384Help
Entry
OSTLU_45384       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_45384
Enzymes [BR:olu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OSTLU_45384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 1336 aa AA seqDB search
MSSGSRGLFTTVDPEVRRIVPEAKGRVVVKVTYVVLEAQYQSALSAAVKQINETNDKVCV
EVTGYLLEELRNADNLAALKKDVESSNIFIGSLIFIEELAEKIVEIVTPCRENLDACLIF
PSMPQVMRLNKLGTFSMAQLGQSKSAIASFMRKKKESGGFEEGMLKLVRTLPKVLKYLPS
DKAADARNFMNSLQYWLGGSTDNLENFLLMISKAYVPELKGVELTVAEPEVFPDVGIWHP
SAPMYYEDLKEYLNWYDTRKDIKFKADAPVIGLVLQRSHLVTGDSGHYDGMVMELEAKGA
KVVPIFAGGLDFSGPIEQFFFDPITKGAYVDTVLSLTGFALVGGPARQDHPKAIESLKKL
NVPYMVTVPLSFQTTEEWKDSTLGLHPVQVALQVALPELDGGLEPMIFSGRDSKSGKSHT
LEDRAAQIANRAIKWAGLRKKTAAAKKLAITVFSFPPDKGNVGTAAYLNVFGSIYRVLQG
LRREGYNVGVLPSSEEELINSVLNDKEAQYASPDMNVAYRMPVAEYQKLCLYSEDLHENW
GPPPGNLNTDGQNLLVYGKQFGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFL
EHVFQADAVLHFGTHGSLEFMPGKQVGMAGVCYPDRLIGNIPNIYYYAANNPSEATIAKR
RSYANTISYLTPPAENAGLYKGLKELKELISSYQTLKDSGRGPSIVNTIISTAITCNLDK
DVEEIPTDPEADAANFDADTRDLIVGKVYQKLMEIESRLLPCGLHVVGCPPSAEEAVATL
VNIASIDREDENITALPGLLAMAVGRDIESIYRSNDAGNLEDVQLLQDITEACRSCVRTF
VTAAADPSGRVAAGALASVGKLFGSAAVAVPWGDALKGTKFESADVEKMRTLFDYLRFCL
EQVVKDNELGALTEALEGQYVLPGPGGDPIRNPKVLPTGKNIHALDPQAIPTGAAVASAK
VVVDRLIERERVENGGKYPESIALVLWGTDNIKTYGESLAQVMLMVGVRPAPDALGRVNK
LELISLEELGRPRIDVVVNCSGVFRDLFVNQMNLLDRAVKLAAEQDEPEDMNFVRKHAAE
QAEELGLSIREAATRIFSNASGSYSSNVNLAVENSSWNDESQLQDMYLNRKSFAFNSDAP
GAGMETRKELFESALSKVDVTFQNLDSSEISLTDVSHYFDSDPTKLVAGVRKDGKMPASY
IADTTTANAQVRSLSETMRLDSRTKLLNPKWYEGMMASGYEGTREIQKRLNNTLGWSATS
GAVDNWVYEDANTTFMADPEMQKRLMESNPNSFRKMVANFLEANGRGYWETSEENIDRLR
QLYMEVEDKIEGVDNA
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgggatctcgtgggttgttcacgacggttgatccggaggtgcgacgcatcgtg
cccgaggcgaagggtcgcgtcgtggtcaaggtgacgtacgtcgttttggaggcgcagtac
cagtccgcgctgtccgcggcggtgaaacagattaatgaaaccaacgacaaggtgtgcgtc
gaggttaccggctacttgctcgaggaattgcgcaacgccgataacttggcggcgctcaag
aaggatgtcgagtcttcaaacatcttcatcggttctctcatctttatcgaagagctcgcc
gagaagattgtcgaaatcgtgacgccgtgccgcgaaaacttggacgcgtgcttgatcttc
ccgtccatgccgcaagtcatgcgcttgaacaagctcggcacgttctccatggcgcagctc
ggtcagtccaagtccgccatcgcctcgttcatgcgcaagaagaaggaatccggcggcttt
gaggagggcatgttgaagctcgtccgcacgttgccgaaggtgttgaagtacttgccctcg
gacaaggctgcggatgcgcgcaacttcatgaactctttgcagtactggctcggcggttcc
acggacaacttggagaacttcttgttgatgatctccaaggcgtacgtccccgagctcaag
ggcgtcgagctcacggtggctgagccggaagtgttcccggatgttggcatctggcacccg
tccgcgccgatgtactacgaggacttgaaggagtacctcaactggtacgacacgcgcaag
gacatcaagttcaaggcggacgccccggtcatcggtctcgtgctccagcgctcgcacttg
gtcacgggcgactctggtcactacgacggtatggtcatggagctcgaagccaagggtgcg
aaggtcgtcccgatctttgccggtggcctcgatttctccggcccgatcgagcagttcttc
tttgacccgatcaccaagggtgcgtacgtcgacaccgtcttgtcgttgactggtttcgcc
ctcgtcggcggcccggcgcgtcaagatcacccgaaggcgattgaatccttgaagaagctc
aacgtgccgtacatggtcaccgtcccgctctctttccaaaccaccgaagagtggaaggat
tccacgctcggtttgcacccggtgcaagtcgcgctccaagtcgcgcttccggaactcgac
ggcggcctcgagccgatgatcttctccggtcgcgattccaagtctggtaagtctcacact
ctcgaagatcgcgcggcgcaaatcgcgaaccgcgccatcaagtgggctggccttcgcaag
aagaccgccgcggccaagaagctcgcgatcaccgtcttctctttcccgccggataagggc
aacgtcggtaccgccgcgtacttgaacgtcttcggttccatctaccgcgtgcttcaaggc
ttgcgccgcgagggctacaacgttggtgtgctcccgtccagcgaggaagagctcatcaac
tccgttctcaacgacaaggaggcgcaatacgcgtccccggacatgaacgtcgcctaccgc
atgccggttgccgagtaccaaaagctctgcctctactctgaggacttgcacgagaactgg
ggcccgccgccgggcaacttgaacaccgacggccaaaacttgctcgtgtacggtaagcag
ttcggcaacgttttcatcggtgtccagccgacgttcggctacgaaggtgatcccatgcga
ttgttgttctccaagtctgcgtcgccgcaccacggcttcgcggcgtactacacgttcctc
gagcacgtgttccaagccgacgctgtccttcacttcggtacgcacggttctctcgagttc
atgccgggtaagcaagtcggtatggctggtgtgtgctacccggatcgcttgatcggtaac
attccgaacatctactactacgcggcgaacaacccctcggaggcgacgattgccaagcgt
cgctcttacgcgaacaccatctcgtacttgaccccgccggctgagaacgctggcttgtac
aagggcttgaaggaactcaaggagttgatctcttcttaccaaacgttgaaggattccggc
cgtggtccgtccatcgtcaacaccatcatctccaccgcgatcacgtgcaacttggacaag
gatgtcgaggaaatcccgactgatccggaggctgacgccgcgaactttgatgccgacacc
cgcgatttgatcgtcggtaaggtgtaccaaaagctcatggaaatcgagtctcgtcttttg
ccgtgcggtctccacgtcgtcggatgcccgccgtccgcggaggaagccgtcgccacgctc
gtgaacattgcgtccatcgaccgtgaagacgaaaacatcaccgcgctcccgggtctcctc
gcgatggctgtcggtcgcgatatcgagagcatctacagatccaacgatgccggtaacctc
gaggacgttcagctcttgcaagacatcaccgaggcgtgccgctcgtgcgtccgcacgttt
gtcacggctgccgccgacccgtctggtcgcgtcgccgcgggcgcgctcgcgagcgtcggc
aagctcttcggtagcgctgccgtcgcggttccgtggggtgatgccttgaagggcaccaag
tttgaatctgctgatgtcgaaaagatgcgcactttgttcgattacttgcgcttctgcctc
gagcaagttgtcaaggacaacgagctcggcgcgctcaccgaagccctcgaaggtcaatac
gtgcttccgggtccgggtggtgacccgatccgtaacccgaaggtgttgccgaccggtaag
aacattcacgctcttgacccgcaagcgatcccgaccggtgcggctgttgcctccgccaag
gttgtcgtcgatcgtttgattgaacgcgagcgcgtcgaaaacggtggcaagtacccggag
tccatcgcgctcgttctgtggggtacggacaacattaagacgtacggtgaatctttggcg
caagtcatgttgatggtgggtgtgcgacctgcccccgatgcgctcggtcgggtgaacaag
ctcgagcttatcagtttagaagagctcggtcgcccgcgcatcgacgtcgtcgtcaactgc
tctggcgtcttccgcgatttgttcgtcaaccagatgaacttgttggaccgcgccgtcaag
ctcgccgctgagcaagacgaaccggaggacatgaactttgtccgcaagcacgccgctgag
caagccgaggagcttggcttgtccattcgcgaggcggcgacgcgcatcttctccaacgcg
tctggttcctactcttccaacgtcaacctcgcggttgaaaactcttcttggaacgacgag
agccagctccaagacatgtacctcaaccgtaagtctttcgcgttcaactctgatgctccg
ggtgctggcatggaaacgaggaaggaactcttcgagtctgccttgtccaaggtcgacgtc
accttccaaaacttggattcttccgagatttcgctcaccgacgtcagccactacttcgac
tctgatccgaccaagctcgtcgccggtgtgcgtaaggacggtaagatgccggcttcttac
atcgccgatacgaccacggccaacgctcaagtgcgctctttgtccgagacgatgcgtctg
gactcccgcaccaagctcttgaacccgaagtggtacgaaggcatgatggcgtctggctac
gagggtactcgcgagatccaaaagcgtctcaacaacactctcggctggtccgccacgtct
ggtgccgtcgacaactgggtgtacgaagacgccaacacgaccttcatggctgatccggag
atgcaaaagcgcttgatggagtccaacccgaactcgttccgcaagatggtcgccaacttc
ttggaagccaacggcagaggttactgggagacgtccgaagagaacatcgatcgtttgcga
cagctctatatggaggtcgaagataaaatcgagggcgtcgacaacgcgtga

DBGET integrated database retrieval system