KEGG   Ostreococcus lucimarinus: OSTLU_4731Help
Entry
OSTLU_4731        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     OSTLU_4731
Protein kinases [BR:olu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   OSTLU_4731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 267 aa AA seqDB search
LGVADLDIVGVIGTGSGGVVRLAKHKRTDEALAVKNIAISLARDDDGRKRIITELRTLHK
SSCEYIVRSLGAFFDQGSVNLVMEYMEAGTMSDATKYLGPWGEDDLAAATAMLADGLHYL
HTKLSVVHRDIKPCNVLLNLRGEAKLSDFGVSGHLVDASKCHSWVGTVTYMSPERIQGES
YEFTADVWSFALTVMECALGRFPYNSPDVARRYSFWDLLDVVVKEPVPCLRPELNVSEEF
DNFVALGLNKDPSGRMLARNMIAHPWI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttaggcgtggcggatctggacatcgtgggggtgatcgggacggggtcgggaggggtggtg
cggttggcgaagcataagcgaacggacgaggcgctggcggtgaagaatatcgcgatttca
ctcgcgagggacgacgatgggcgaaaacgcatcatcaccgagcttcgtacgttgcacaag
agctcgtgcgagtacatcgttcgtagtctaggggcatttttcgatcaggggagcgtcaac
ttggtgatggagtacatggaggcgggcacgatgagcgacgcaaccaagtatctcggaccg
tggggagaggacgatttagccgcggcgacggcgatgttagcggatggattacattattta
cacacgaaattgagtgtcgtccatcgagacatcaaaccgtgtaacgtcctgctcaattta
cgcggcgaggcgaaactgagcgatttcggcgtgagcggacatctcgtcgacgcgagtaaa
tgtcactcgtgggtgggaacggttacgtacatgtcacccgagcgtattcagggtgagtca
tacgagttcaccgcggacgtgtggagtttcgctctcactgtcatggagtgcgcgctcggt
cggtttccgtacaattcgcccgacgtcgcgaggcggtatagcttttgggatctactcgat
gtcgtcgtcaaagagcccgtgccttgtcttcgacccgagctcaacgtttcggaggaattc
gacaatttcgtcgccttgggcttgaacaaagaccctagcggtcgcatgttggcgagaaac
atgatcgcgcacccgtggatt

DBGET integrated database retrieval system