KEGG   Ostreococcus lucimarinus: OSTLU_4881Help
Entry
OSTLU_4881        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
olu  Ostreococcus lucimarinus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OSTLU_4881
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     OSTLU_4881
Transfer RNA biogenesis [BR:olu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    OSTLU_4881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 318 aa AA seqDB search
AARAVRLAGALCRKMQFELRTNEKVSKSDDSPVTVADFAAQAVVSHVLGVARPDVGLVAE
EDARSMREPAGAKLRARVTAVVNDALEGVVERRLSEEEVMDAIDRGATDGGASGSFWILD
PIDGTKGFINGRQYAIALALMEDGEVTGGVLGCPNMPSEKIPRGATEIPTAAPGVIFVAY
KGRGTTVGAFDAEHPLRDGAKITTNKVASSSEATYMESWGDSIVADHGFTNSLSAAMGVT
APPVRIDSMAKYGALARGDTNMYLRFPPASYREKVWDHAAGAIVVQEAGGVITDGAGNPL
DFSKGRFLDIDIGIVATS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gccgcgcgcgcggtgcggctcgcgggcgcgctgtgccggaagatgcagttcgagctgcga
acgaacgaaaaagtgtcgaaatcggacgactcgccggtgacggtggcggatttcgcggcg
caggcggtggtgtcgcacgtcctgggcgtcgcgaggccggacgtcgggctggtggcggag
gaagacgcgcggagtatgcgggaaccagcgggcgcgaaattgcgagcgagagtgacggcg
gtggtgaacgatgcgctcgaaggcgtggtggagcgcagactgagcgaggaggaggtcatg
gacgcgatcgatcgcggggcgacggacggcggcgcgtcggggtcgttttggattctcgat
ccaatcgacggcacgaaaggattcattaatggtcggcagtacgccatcgctttggcgctc
atggaggacggcgaagttacgggtggtgttctcgggtgtccgaacatgccgagcgagaag
ataccgcgaggagcgacggaaattccgacggcggcgccgggagtaattttcgtcgcgtac
aaggggcgcgggacgactgtgggggcgttcgacgcggagcatcctctgcgagatggcgcg
aaaataacgacgaataaagtggccagttcgagcgaagcgacgtacatggaatcgtggggg
gactccatcgtcgccgatcatgggtttacgaattctttgagcgcggcgatgggcgtaacg
gcgccgcccgtgcgcatcgatagcatggcaaagtacggtgcgctcgcccgtggagacacg
aatatgtatctcaggtttccgcccgcgagttatagagaaaaagtttgggatcacgccgcg
ggcgcgatcgtggttcaggaggcgggaggggtcatcaccgatggcgccgggaatccactc
gatttttcaaagggacgatttttggacatcgacatcggcatcgtggccacgtct

DBGET integrated database retrieval system