KEGG   Ostreococcus lucimarinus: OSTLU_49128Help
Entry
OSTLU_49128       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
olu  Ostreococcus lucimarinus
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    OSTLU_49128
  Lipid metabolism
   00071 Fatty acid degradation
    OSTLU_49128
   00592 alpha-Linolenic acid metabolism
    OSTLU_49128
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OSTLU_49128
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     OSTLU_49128
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OSTLU_49128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 722 aa AA seqDB search
MSPVTTKIDDGVAVIELNNPPVNALAVPVLEGLERAVKDAQANSNVRAIVIHGAGGKFSG
GFDITQLRKSTQGKPSNDVGDFNAILCRYVEGGSKPCVAAIENLALGGGLEVAMSCNARV
ATPRAQLGLPELQLGVIPGFGGTQRLPRLVGLEKSLEMMLKSKSIKAEEALKLGLVDKIA
DPSRIVAEASALAKAIASGSVKRELSMYRKDKLPDPKSTEMILKEASKKAKRVQSVMPHV
ALCVDAISVGLAQGPEEGLKREAENFKKAVSSPAAKGLVHFFFAQRATNVVPGITDVGLK
PRPMKSVGVVGGGLMGSGIATACLLAGIQVVLKEIKQEFLDAGVGRIQSNLTSMVRKGRM
TEDKARQLMSLVKPTLTDQDFRQCDMVIEAVIENLPLKQKIFCELERICKPDCILSTNTS
TIDITKIAAKMKNPERIVGAHFFSPAHVMQLFEIIRTDATPAQILVDTLGLSKQIKKTPV
VVGNCTGFAVNRIFFPYTMSATVLVDIGCDPYAIDRAIMMFGMPMGPFRLGDLVGHDVGV
HVGQNFIDDFPDRVYRSPLIPSLLANKRLGEKSGAGFYKYDNKRRATPDSEGVEMLIAAS
RAQSKLPLDGSPIPAGLSPQEIAEMIFFPVVNEACRVLSEGIVVKAGDIDTAAILGMGFP
AFRGGVVHWGDSVGPAVIAAKLRAWSTKYGGLYQPCPYLENCAIQGRTLAQGPLDTKIKS
RL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggtgacgacgaaaatcgacgacggcgtggcggtgatcgagctgaataacccc
ccggtgaacgcgctggcggtgccggtactcgagggactcgagcgcgcggtaaaggacgcg
caggcaaactcgaacgtgcgcgcgatcgtcatccacggggcgggcggaaagtttagcggc
ggtttcgacattacgcaattgagaaagtcgacccaggggaagccgtcgaacgacgtgggc
gattttaacgcgattctgtgccgatacgtggagggtggaagtaagccgtgcgtggcggcg
atcgaaaacttggctctaggagggggattggaggtggcgatgtcgtgcaacgcgcgcgtg
gcgacgccgagggcgcagttggggttgcctgagcttcagttgggagtgattcctgggttt
ggtggcactcaacgcctgccgcggttggtgggcttggagaagtccctggagatgatgctg
aagagcaagtcgatcaaggcggaggaggcgctgaaacttggattggttgacaaaattgcg
gacccgtcaagaatcgtcgccgaggcgtcggcgttggcgaaggcgatcgcgagtggctcc
gtgaagcgggagctttcgatgtatcgtaaagacaaactaccagatcccaagtctacggag
atgattctcaaggaggcgagcaagaaggccaagcgagtgcagtcagtgatgccgcacgtg
gcgctttgcgtcgatgccatctcggtcggactcgcccaaggccctgaagagggactgaag
cgcgaggcagaaaactttaaaaaggctgtatcatcgcctgccgcgaaaggtttggttcac
ttcttcttcgctcagcgcgcgacgaacgtagttccgggaatcacggacgtcggccttaag
cctcgaccgatgaagtcagtcggcgtcgtcggaggcggtttgatggggagtggaatcgcc
acggcgtgcttgctcgctggaattcaagtcgtgttgaaagagatcaagcaagagtttttg
gacgcgggcgtcggtcgcattcaatcaaacttgacgagcatggttcgtaaaggcaggatg
actgaagacaaggcgcgccagctgatgtcgctcgtcaagcctacactcacagatcaagat
ttccgtcagtgtgatatggtcatcgaggctgtcattgaaaacttacctctcaagcaaaag
atcttctgtgagttggagaggatttgcaagcctgattgcatcttgagcacgaacacgagt
accatcgacattacaaaaatcgccgccaaaatgaagaacccagagcgcatcgtgggtgct
catttcttttcacctgctcatgtcatgcagctgttcgaaattattcgtaccgacgcgact
ccggcgcagattttggtggacaccttgggcttgagtaaacaaattaagaagacgcctgtc
gtcgtgggaaactgcaccggattcgccgtcaaccgtatcttctttccgtacaccatgagc
gcgacggtgctcgtggatattgggtgcgatccgtacgccatcgatcgtgcgataatgatg
tttggaatgcccatgggtccgttccgtttgggtgatttggtcggtcacgatgtcggcgtt
cacgtcgggcagaacttcatcgacgatttccccgatcgagtctaccgctcgcccctcatc
ccatcgttgctcgcgaacaaaagattgggcgagaagtccggtgctggattttacaagtac
gacaataagcgccgggccacgcctgattccgagggtgtcgagatgctcatcgccgcgtcc
cgagcgcagtccaaacttccgctcgacggttcgcccattccggcgggcttgagtccgcaa
gagatcgctgagatgatctttttcccggtcgtcaacgaagcgtgcagagttctttccgaa
ggcatcgtcgtcaaggctggcgatatcgacaccgcggcaatcttaggcatgggcttccct
gcctttcgaggcggcgtcgtccactggggcgactccgtcggccccgccgtgatcgccgcc
aagctccgcgcttggtccaccaagtacggcggtctgtaccaaccgtgtccttacttagag
aactgcgccattcagggtcgcaccctcgctcagggtccgttggacaccaaaattaaatct
cgtctttag

DBGET integrated database retrieval system