KEGG   Ostreococcus lucimarinus: OSTLU_49484Help
Entry
OSTLU_49484       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:olu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:olu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:olu00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 302 aa AA seqDB search
MAASASRALRAAPRAPRASRARRNPERGAASRAVATRASVSEAFKAVLDDGKRAFIPFIC
AGDPDLESTKKALKILDDAGADVIELGVPYSDPLADGPVIQAAATRALENGATLNKVIDL
VREMTPQIKAPIVMFTYYNPIYQRGVDKFCADIAAAGAKGLLVPDIPLEETYDVSEIASK
HGIELVLLSTPTTPVERAKKIAQATKGFVYLVSVTGVTGVQSNVATRVEQLVEELRSVTD
KPIAVGFGVSEAKHAKQIVDWGADGVIVGSALVRALGEAKTPEEGLAALKAKAEEIRGGA
TL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgagcgcgtcccgcgcgcttcgcgcggcgccgcgcgcgccgcgcgcgtcccgc
gcccgccgtaaccctgaacgcggcgccgcgtctcgcgccgtggcgacgcgcgcgagcgtg
tccgaggcgttcaaggcggtgctggacgatggcaagcgagcgttcattccgttcatctgc
gcgggcgatcccgatctggagagcacgaagaaggcgctgaagattttggacgacgcgggc
gcggatgtcatcgagctcggcgtgccgtacagcgacccgttggcggacggaccggtgatt
caggcggcggcgacgcgggcgttggagaacggggcgacgttgaataaggtgatcgattta
gtgcgagagatgacgccgcagattaaggcgccgatcgtgatgtttacgtattacaatccg
atttatcaacgcggagtggataaattttgcgccgacatcgccgcggctggggcgaaggga
ttgctcgtgccggatattccgttggaggagacgtacgatgtgagcgagatcgcgagtaag
cacggcatagagctcgttctgctttccacgcccacgacgccggtggaacgggcgaagaag
attgcgcaggcgacgaaggggttcgtctacctcgtctccgtcacgggcgtcaccggcgtg
caatcgaacgtggcgacgcgcgtggagcaattggtggaggagttgagaagcgtgacggat
aagcccatcgcggtcgggttcggggtgagcgaggcaaagcacgcgaagcaaatcgtggat
tggggcgccgacggcgtcatcgtcggttccgcgctcgtgcgcgcgctcggcgaagccaag
acgcccgaggaaggtctcgccgcgctcaaggccaaggctgaggaaatccgcggtggcgcc
acgctctga

DBGET integrated database retrieval system