KEGG   Ostreococcus lucimarinus: OSTLU_49484Help
Entry
OSTLU_49484       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00260  Glycine, serine and threonine metabolism
olu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01230  Biosynthesis of amino acids
Module
olu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OSTLU_49484
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OSTLU_49484
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OSTLU_49484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG Ribul_P_3_epim FMN_dh PcrB NanE ABC_sub_bind
Motif
Other DBs
NCBI-GeneID: 5001442
NCBI-ProteinID: XP_001417123
JGI: 49484
UniProt: A4RVE9
Position
4:36337..37245
Genome map
AA seq 302 aa AA seqDB search
MAASASRALRAAPRAPRASRARRNPERGAASRAVATRASVSEAFKAVLDDGKRAFIPFIC
AGDPDLESTKKALKILDDAGADVIELGVPYSDPLADGPVIQAAATRALENGATLNKVIDL
VREMTPQIKAPIVMFTYYNPIYQRGVDKFCADIAAAGAKGLLVPDIPLEETYDVSEIASK
HGIELVLLSTPTTPVERAKKIAQATKGFVYLVSVTGVTGVQSNVATRVEQLVEELRSVTD
KPIAVGFGVSEAKHAKQIVDWGADGVIVGSALVRALGEAKTPEEGLAALKAKAEEIRGGA
TL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgagcgcgtcccgcgcgcttcgcgcggcgccgcgcgcgccgcgcgcgtcccgc
gcccgccgtaaccctgaacgcggcgccgcgtctcgcgccgtggcgacgcgcgcgagcgtg
tccgaggcgttcaaggcggtgctggacgatggcaagcgagcgttcattccgttcatctgc
gcgggcgatcccgatctggagagcacgaagaaggcgctgaagattttggacgacgcgggc
gcggatgtcatcgagctcggcgtgccgtacagcgacccgttggcggacggaccggtgatt
caggcggcggcgacgcgggcgttggagaacggggcgacgttgaataaggtgatcgattta
gtgcgagagatgacgccgcagattaaggcgccgatcgtgatgtttacgtattacaatccg
atttatcaacgcggagtggataaattttgcgccgacatcgccgcggctggggcgaaggga
ttgctcgtgccggatattccgttggaggagacgtacgatgtgagcgagatcgcgagtaag
cacggcatagagctcgttctgctttccacgcccacgacgccggtggaacgggcgaagaag
attgcgcaggcgacgaaggggttcgtctacctcgtctccgtcacgggcgtcaccggcgtg
caatcgaacgtggcgacgcgcgtggagcaattggtggaggagttgagaagcgtgacggat
aagcccatcgcggtcgggttcggggtgagcgaggcaaagcacgcgaagcaaatcgtggat
tggggcgccgacggcgtcatcgtcggttccgcgctcgtgcgcgcgctcggcgaagccaag
acgcccgaggaaggtctcgccgcgctcaaggccaaggctgaggaaatccgcggtggcgcc
acgctctga

DBGET integrated database retrieval system