KEGG   Ostreococcus lucimarinus: OSTLU_49676Help
Entry
OSTLU_49676       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
olu  Ostreococcus lucimarinus
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OSTLU_49676
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OSTLU_49676
   00670 One carbon pool by folate
    OSTLU_49676
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     OSTLU_49676
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     OSTLU_49676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 499 aa AA seqDB search
MNDGKFQVVVAATREGGIGRENALPWRLAGDMGYFKKITSETRDGDAMNAVVMGRKTWES
IPGKFRPLPGRLNIVLSRSGGLAEANDENNNGAETLPEGVLVRKSIDDALSAISSSEKRI
EKTFVIGGAQIYEEALQSEKCEAVHLTEVEGEFECDAFIPKIDATKFKLYGQSKPMIEKG
TRFQFLTYVTADAESGKFRPKADEVLPAGCSIKHEEYQYLEMIREIIDQGAVKGDRTGTG
TISTFGNQMRFDLRRSFPLLTTKRVFWRGVAEELLWFVAGETNANKLAEKKINIWDGNGS
REYLDSIGLTEREVGDLGPVYGFQWRHFGAEYTNMHADYTGKGVDQLAEVIHKIKNNPND
RRILLTAWNPAALKEMALPPCHMFCQFYVANGELSCQMYQRSCDMGLGVPFNIASYSLLT
CMIAQVCGLKPGDFVHCCGDTHVYSNHVEPLEKQLACEPRPFPILKINPEKKDIDSFTFD
DFEIVGYDPHPKIEMKMAV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatggaaagtttcaagtcgtcgtcgcggcgacgcgcgagggagggatcgggagg
gagaacgcgctgccgtggcgactcgccggggacatgggatactttaaaaagattacgagc
gagacgcgggacggggacgcgatgaacgcggtggtgatggggagaaagacgtgggaatcg
attccggggaaattcagaccgctgccgggaaggttgaacatcgtgctgagtcgaagcggg
ggattggcggaggcgaacgacgagaataataacggcgcggagacgctgccggagggggtg
ctggtgcgtaagtccatcgatgacgcgctgagcgcgatttcgtcgagcgaaaagaggatt
gagaagacgtttgtgatcggtggggcgcaaatttacgaagaggcgcttcaaagcgaaaag
tgcgaagccgtgcacctcaccgaggtggagggcgaattcgaatgcgacgccttcatcccg
aagatcgacgccaccaagttcaagctctatggacagtccaagcccatgattgagaaaggc
acgaggtttcaatttttgacgtacgtcactgccgacgccgagagcggaaagttccgcccg
aaggccgacgaggttctgcccgcgggttgctcgatcaagcacgaagaataccagtacttg
gaaatgattcgcgaaatcatcgatcaaggcgcggtgaagggcgatcgcaccggcactggg
acgatttctacgtttggcaatcaaatgcgtttcgatcttcgccgatcgtttccacttctc
acgaccaagcgcgtcttctggcgcggcgtcgcggaagagttgctgtggttcgtcgccggc
gagacgaacgcgaacaagttggccgagaaaaagatcaacatctgggatggtaacggaagt
cgcgagtacttggattctattggtttgactgaacgcgaagtcggtgatctcggtccggtg
tacggattccagtggagacacttcggcgccgagtacacgaacatgcacgccgactacact
ggcaagggcgtggaccaactcgctgaggtcattcacaagatcaagaacaacccgaacgat
cgtcgcattttactcacggcgtggaatccggcggcgttgaaggagatggcgttgccaccg
tgccacatgttctgccagttttacgttgccaacggcgagttgagctgccaaatgtaccaa
cgctcgtgcgacatgggtctgggcgttcctttcaatatcgcttcgtattccttgctcacg
tgcatgattgcgcaagtttgcggtttgaaacctggtgattttgtgcactgctgcggagac
acgcacgtatactcgaaccacgtggagccgctcgaaaagcagctcgcgtgcgagccgcga
ccgtttccgattttgaaaatcaacccggaaaagaaggatatcgactccttcacctttgac
gacttcgagatcgtcggttacgatccccaccctaaaattgagatgaaaatggccgtctaa

DBGET integrated database retrieval system