KEGG   Ostreococcus lucimarinus: OSTLU_49676Help
Entry
OSTLU_49676       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
olu  Ostreococcus lucimarinus
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:olu00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:olu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:olu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 499 aa AA seqDB search
MNDGKFQVVVAATREGGIGRENALPWRLAGDMGYFKKITSETRDGDAMNAVVMGRKTWES
IPGKFRPLPGRLNIVLSRSGGLAEANDENNNGAETLPEGVLVRKSIDDALSAISSSEKRI
EKTFVIGGAQIYEEALQSEKCEAVHLTEVEGEFECDAFIPKIDATKFKLYGQSKPMIEKG
TRFQFLTYVTADAESGKFRPKADEVLPAGCSIKHEEYQYLEMIREIIDQGAVKGDRTGTG
TISTFGNQMRFDLRRSFPLLTTKRVFWRGVAEELLWFVAGETNANKLAEKKINIWDGNGS
REYLDSIGLTEREVGDLGPVYGFQWRHFGAEYTNMHADYTGKGVDQLAEVIHKIKNNPND
RRILLTAWNPAALKEMALPPCHMFCQFYVANGELSCQMYQRSCDMGLGVPFNIASYSLLT
CMIAQVCGLKPGDFVHCCGDTHVYSNHVEPLEKQLACEPRPFPILKINPEKKDIDSFTFD
DFEIVGYDPHPKIEMKMAV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatggaaagtttcaagtcgtcgtcgcggcgacgcgcgagggagggatcgggagg
gagaacgcgctgccgtggcgactcgccggggacatgggatactttaaaaagattacgagc
gagacgcgggacggggacgcgatgaacgcggtggtgatggggagaaagacgtgggaatcg
attccggggaaattcagaccgctgccgggaaggttgaacatcgtgctgagtcgaagcggg
ggattggcggaggcgaacgacgagaataataacggcgcggagacgctgccggagggggtg
ctggtgcgtaagtccatcgatgacgcgctgagcgcgatttcgtcgagcgaaaagaggatt
gagaagacgtttgtgatcggtggggcgcaaatttacgaagaggcgcttcaaagcgaaaag
tgcgaagccgtgcacctcaccgaggtggagggcgaattcgaatgcgacgccttcatcccg
aagatcgacgccaccaagttcaagctctatggacagtccaagcccatgattgagaaaggc
acgaggtttcaatttttgacgtacgtcactgccgacgccgagagcggaaagttccgcccg
aaggccgacgaggttctgcccgcgggttgctcgatcaagcacgaagaataccagtacttg
gaaatgattcgcgaaatcatcgatcaaggcgcggtgaagggcgatcgcaccggcactggg
acgatttctacgtttggcaatcaaatgcgtttcgatcttcgccgatcgtttccacttctc
acgaccaagcgcgtcttctggcgcggcgtcgcggaagagttgctgtggttcgtcgccggc
gagacgaacgcgaacaagttggccgagaaaaagatcaacatctgggatggtaacggaagt
cgcgagtacttggattctattggtttgactgaacgcgaagtcggtgatctcggtccggtg
tacggattccagtggagacacttcggcgccgagtacacgaacatgcacgccgactacact
ggcaagggcgtggaccaactcgctgaggtcattcacaagatcaagaacaacccgaacgat
cgtcgcattttactcacggcgtggaatccggcggcgttgaaggagatggcgttgccaccg
tgccacatgttctgccagttttacgttgccaacggcgagttgagctgccaaatgtaccaa
cgctcgtgcgacatgggtctgggcgttcctttcaatatcgcttcgtattccttgctcacg
tgcatgattgcgcaagtttgcggtttgaaacctggtgattttgtgcactgctgcggagac
acgcacgtatactcgaaccacgtggagccgctcgaaaagcagctcgcgtgcgagccgcga
ccgtttccgattttgaaaatcaacccggaaaagaaggatatcgactccttcacctttgac
gacttcgagatcgtcggttacgatccccaccctaaaattgagatgaaaatggccgtctaa

DBGET integrated database retrieval system