KEGG   Ostreococcus lucimarinus: OSTLU_49676Help
Entry
OSTLU_49676       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K13998  dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00240  Pyrimidine metabolism
olu00670  One carbon pool by folate
olu00790  Folate biosynthesis
olu01100  Metabolic pathways
Module
olu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OSTLU_49676
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OSTLU_49676
   00670 One carbon pool by folate
    OSTLU_49676
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     OSTLU_49676
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     OSTLU_49676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt DHFR_1
Motif
Other DBs
NCBI-GeneID: 5001729
NCBI-ProteinID: XP_001417778
JGI: 49676
UniProt: A4RXM1
Position
5:460865..462364
Genome map
AA seq 499 aa AA seqDB search
MNDGKFQVVVAATREGGIGRENALPWRLAGDMGYFKKITSETRDGDAMNAVVMGRKTWES
IPGKFRPLPGRLNIVLSRSGGLAEANDENNNGAETLPEGVLVRKSIDDALSAISSSEKRI
EKTFVIGGAQIYEEALQSEKCEAVHLTEVEGEFECDAFIPKIDATKFKLYGQSKPMIEKG
TRFQFLTYVTADAESGKFRPKADEVLPAGCSIKHEEYQYLEMIREIIDQGAVKGDRTGTG
TISTFGNQMRFDLRRSFPLLTTKRVFWRGVAEELLWFVAGETNANKLAEKKINIWDGNGS
REYLDSIGLTEREVGDLGPVYGFQWRHFGAEYTNMHADYTGKGVDQLAEVIHKIKNNPND
RRILLTAWNPAALKEMALPPCHMFCQFYVANGELSCQMYQRSCDMGLGVPFNIASYSLLT
CMIAQVCGLKPGDFVHCCGDTHVYSNHVEPLEKQLACEPRPFPILKINPEKKDIDSFTFD
DFEIVGYDPHPKIEMKMAV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatggaaagtttcaagtcgtcgtcgcggcgacgcgcgagggagggatcgggagg
gagaacgcgctgccgtggcgactcgccggggacatgggatactttaaaaagattacgagc
gagacgcgggacggggacgcgatgaacgcggtggtgatggggagaaagacgtgggaatcg
attccggggaaattcagaccgctgccgggaaggttgaacatcgtgctgagtcgaagcggg
ggattggcggaggcgaacgacgagaataataacggcgcggagacgctgccggagggggtg
ctggtgcgtaagtccatcgatgacgcgctgagcgcgatttcgtcgagcgaaaagaggatt
gagaagacgtttgtgatcggtggggcgcaaatttacgaagaggcgcttcaaagcgaaaag
tgcgaagccgtgcacctcaccgaggtggagggcgaattcgaatgcgacgccttcatcccg
aagatcgacgccaccaagttcaagctctatggacagtccaagcccatgattgagaaaggc
acgaggtttcaatttttgacgtacgtcactgccgacgccgagagcggaaagttccgcccg
aaggccgacgaggttctgcccgcgggttgctcgatcaagcacgaagaataccagtacttg
gaaatgattcgcgaaatcatcgatcaaggcgcggtgaagggcgatcgcaccggcactggg
acgatttctacgtttggcaatcaaatgcgtttcgatcttcgccgatcgtttccacttctc
acgaccaagcgcgtcttctggcgcggcgtcgcggaagagttgctgtggttcgtcgccggc
gagacgaacgcgaacaagttggccgagaaaaagatcaacatctgggatggtaacggaagt
cgcgagtacttggattctattggtttgactgaacgcgaagtcggtgatctcggtccggtg
tacggattccagtggagacacttcggcgccgagtacacgaacatgcacgccgactacact
ggcaagggcgtggaccaactcgctgaggtcattcacaagatcaagaacaacccgaacgat
cgtcgcattttactcacggcgtggaatccggcggcgttgaaggagatggcgttgccaccg
tgccacatgttctgccagttttacgttgccaacggcgagttgagctgccaaatgtaccaa
cgctcgtgcgacatgggtctgggcgttcctttcaatatcgcttcgtattccttgctcacg
tgcatgattgcgcaagtttgcggtttgaaacctggtgattttgtgcactgctgcggagac
acgcacgtatactcgaaccacgtggagccgctcgaaaagcagctcgcgtgcgagccgcga
ccgtttccgattttgaaaatcaacccggaaaagaaggatatcgactccttcacctttgac
gacttcgagatcgtcggttacgatccccaccctaaaattgagatgaaaatggccgtctaa

DBGET integrated database retrieval system