KEGG   Ostreococcus lucimarinus: OSTLU_50249Help
Entry
OSTLU_50249       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
olu  Ostreococcus lucimarinus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    OSTLU_50249
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    OSTLU_50249
Enzymes [BR:olu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     OSTLU_50249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 495 aa AA seqDB search
MTDELSHYFVNSSHNTYLDGGQLFSRSTSSAIAWALERGCRVVELDCYDGGSKGPIITHG
GTAVRPMLFKDAIAVINDRAHVASEYPVIVTLENHASRETRAVMAKIMRHTFGDKLWTPP
SKGEGEGEEESYVLDRWPSPAELKGKVIIRDKSTKATLSTGKNKLSVANSVVNLSKSAPA
GVPEDSDGTSEDDGGEDDEDIKALVSLRNLKFHGFKEAKDLGTKFSCSWSENKAKKLVEK
SSQKDLLEFTKAHLLRTYPGGQRIMSNNYDPSDAWSIGASLVALNFQAQDRYMWVNQAKF
AVNGGCGYVKKPDYLINPSVQRPTKPRILRIHVFCGLGWENFKDADFMSAPDTFMKISLF
GCVADRLSATSRGNSMRTSVYSKARVGPCAQPIWNEHFDLEIREPELTVLQIQAMDKDGA
RDEFLAHYDVAVSALREGVRIVPLLARDDEYVHDSKSCAGVLCKFEWLDEKSSSNDALPA
RTNESKETTNISEDA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgaattgtcgcactattttgtgaattcttcgcataatacgtacttggacggc
ggacagttgttctcgaggtcgacgagttcggccatcgcgtgggcgctcgaacgcgggtgc
agagtcgtcgagctggactgttacgacggagggtcgaaggggccgatcatcacgcacgga
gggacggcggtgcgcccgatgttgtttaaggacgcgatcgcggttatcaacgacagggca
cacgtagctagcgagtatccggtgattgtgactttggagaatcacgcgagtcgggagacg
cgcgcggtgatggcgaaaatcatgcgacacacgttcggcgataaactctggacgccgccg
tcgaaaggcgaaggcgaaggcgaagaagaatcatacgtgttggaccgctggccatcgccg
gccgagttgaagggtaaagtgataattcgggacaagagcaccaaagctacactttcaact
gggaaaaacaagctctcggtggcgaactccgtggtcaacctctccaaaagtgcgcctgca
ggcgttcctgaagactccgatgggacgagcgaggacgacggcggcgaggacgacgaggac
atcaaggcactcgtctcattgcgaaatttgaagtttcatggtttcaaggaagcgaaagat
ctcggtacaaagttttcttgcagttggagcgagaacaaggccaagaaattagtcgaaaag
tcgagccaaaaggatttgctcgaattcaccaaggcgcatttgcttcgcacgtacccgggc
ggtcaacgcatcatgagtaacaattacgatccctccgacgcgtggtccataggcgcatcg
ctcgtcgcgctcaactttcaggcgcaagacagatatatgtgggtgaaccaagccaagttt
gcggtcaacggtgggtgcggttacgtgaaaaagcccgactatttaatcaacccgtcggtt
caaagaccgaccaagcctagaattctgcgcatacacgtcttctgcggactaggttgggaa
aatttcaaggatgccgatttcatgtcggcaccggatacgttcatgaagatttccctcttc
ggttgcgtcgccgatcgcttgtccgcgacttccagagggaattcaatgagaacgtcggtg
tactccaaggcacgagtcggtccgtgcgctcaacccatttggaacgagcactttgacttg
gaaattcgcgagcccgaactcacggtgctacaaatccaagccatggacaaagatggcgcg
cgcgatgagttcctcgcacactacgacgtcgccgttagcgctttgcgcgaaggcgtccgc
attgtaccgttgctcgcgcgcgacgacgaatacgtacacgacagcaagtcctgcgctggc
gttttgtgcaagtttgagtggctcgatgagaaaagctcgtccaacgatgctctgccagct
cgaacgaacgagtcaaaagagacgaccaacatctccgaagatgcgtaa

DBGET integrated database retrieval system