KEGG   Ostreococcus lucimarinus: OSTLU_50484Help
Entry
OSTLU_50484       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     OSTLU_50484
Protein kinases [BR:olu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   OSTLU_50484
Spliceosome [BR:olu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    OSTLU_50484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 383 aa AA seqDB search
MEKKTTRARAGRANDADGHLRYALGDALTNEYKIISLLGEGTFGRVLECWDAISERRCAI
KVIRNVQKYRDAAMVEIEVLKTLAEGDASRRDGERFNCIALRRAFDYQGHVCMVFDKCGP
SLYDFLRSNRYKPFHPKTVQSFCEQTLVAVRYLHTLGLVHTDLKPENILLMSSSYLENAT
YRVPVDHTIRLIDFGSTTFVERHHSAVVSTRHYRAPEIILGLGWSYPCDMWSIGCIMIEL
LTGEALFQTHDNLEHLAMMQHALESAIPVAVARRAPKDKHSEFFTTNGSLNWPNDQTDNE
SYAALGKTGIVRNLIDKQLAGEARELFYDLISRLLNFDPKRRLTSNQAVAHPFFSVNLDQ
MDWKINTRNGSQLRPKSLEKSRS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagacgacgcgggcgagagcgggacgagcgaacgacgccgatgggcacctg
cgatacgcgctcggggacgcgctgacgaatgagtacaagatcatctctttgctcggcgag
gggactttcggtagggttttggaatgctgggacgcgatatccgagcgacgctgcgcgatc
aaggtgattcgaaacgtacaaaagtatcgcgacgcggcgatggtggaaatcgaagtcttg
aagacgctcgccgagggcgacgcgtcgcggagggatggcgaacggttcaattgcatcgcg
ctcaggcgggcgttcgattatcaaggacacgtgtgcatggtgtttgataagtgcggaccg
agtctgtatgactttttgcgatcgaatcgatacaagccatttcatccgaagacggtgcag
agcttttgcgagcagacgctcgtagcggtgcgatacttgcacacgctcggactcgtgcac
acggacttgaagcccgagaatattctcttgatgtcgagttcgtacctcgaaaacgccacg
tatcgcgtcccagtcgatcatacgattcgcttgattgattttgggagcacgacgtttgtc
gaacggcatcacagcgccgtagtatcgacgcgacactaccgcgcccctgaaatcattctt
ggcctcggttggtcgtatccgtgcgacatgtggtccatcggatgcataatgatcgagctt
ctcacgggtgaagcgttatttcaaacccacgataacctcgagcacttggccatgatgcaa
cacgccctcgaaagcgccatccccgtcgccgtcgcgagacgcgcgcccaaggacaagcac
agcgagtttttcacgaccaacggatcgttgaattggccaaatgatcaaactgacaacgag
tcgtacgccgcgctcgggaaaacgggcatcgttcgaaacttgatcgacaagcagctcgcg
ggcgaggcgcgagagttgttttacgatttgattagtcgcttgctcaatttcgaccccaag
cgacgcttgacgtcgaatcaggcggtggctcacccattcttttcagtcaatctcgatcag
atggattggaagatcaacacgcgcaacggtagtcaactacgaccgaagagtctggagaag
tcgcgctcgtga

DBGET integrated database retrieval system