KEGG   Ostreococcus lucimarinus: OSTLU_51664Help
Entry
OSTLU_51664       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:olu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:olu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16
AA seq 358 aa AA seqDB search
MGTKTRSITAPGVIELGDENNDAVVWKRLGQEGVDKAVELWSSVNSEAAAAAKGAWAGVK
PAHKVFLSDILASPKRNAFLRKWIPTDITYVSFIGVMHLGCLLAPFTFTWGAFKCFLAMY
FITGCLGITLSYHRQIAHKSFRTPKWLEYALAYCGALAMQGDPLEWASSHRYHHQHCDTP
KDPHTPYEGFWWSHAGWLLDNEATIERVGDRSNAQELAAQPFYRFMEKTYIWHIAASAAV
LFALGGLPWLVWGFCVRTVWVWHITWAVNSVAHCWGSQEFNTGDLSRNNWLIGILAYGEG
WHNNHHAFEFSARHGLRWWQIDMTWMVISVLKFFRLADKVKLPKEAQMERMRFQPTQA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaagacgcgaagcatcacggcgccgggggtgatcgagctcggggacgagaac
aacgacgcggtggtttggaagagactcggacaagaaggcgtcgataaggcggtcgagttg
tggagttcggtgaacagtgaggcggcggcggcggcaaaaggggcgtgggccggcgtgaag
cccgcgcacaaggttttcctttcggatattttggcgagtccgaagcgcaacgcgtttttg
agaaagtggattccgacggatatcacgtacgtcagtttcatcggagtcatgcacctcggg
tgcctgctcgcgccgtttactttcacctggggagcgttcaagtgcttcttggcgatgtat
ttcatcactggttgcctcggtatcacgctgagctatcacaggcagattgcgcacaagtcg
ttccgcacgcccaagtggctcgagtacgcgctcgcgtactgcggtgcgttggccatgcaa
ggtgacccgttggagtgggcgtcgagccaccgttaccaccaccagcactgcgacacgccc
aaagacccgcacacgccgtacgaaggcttctggtggtcgcacgccggatggttgttggat
aacgaggcgaccatcgagcgcgtgggggatcgctcgaacgcccaagagctcgcggcgcag
ccgttctaccgcttcatggagaagacgtacatctggcatatcgccgcgtccgccgctgtg
ttgttcgccctcggcggtttgccgtggctcgtttggggtttctgcgtgcgcaccgtgtgg
gtgtggcacatcacttgggcggtgaactcggtggcgcactgctggggttcgcaagagttc
aacacgggtgatttgtctcgcaacaattggctcataggtatcttggcgtacggtgaaggc
tggcacaacaaccatcacgccttcgaatttagcgctcgccacggattacgttggtggcaa
attgatatgacttggatggtcatcagcgtgttgaagttcttccgcttggcggataaggtg
aaactcccgaaggaggcgcagatggaacgcatgcgtttccagccaacccaagcctaa

DBGET integrated database retrieval system