KEGG   Ostreococcus lucimarinus: OSTLU_51664Help
Entry
OSTLU_51664       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    OSTLU_51664
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    OSTLU_51664
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     OSTLU_51664
Lipid biosynthesis proteins [BR:olu01004]
 Desaturase
  First
   OSTLU_51664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16
AA seq 358 aa AA seqDB search
MGTKTRSITAPGVIELGDENNDAVVWKRLGQEGVDKAVELWSSVNSEAAAAAKGAWAGVK
PAHKVFLSDILASPKRNAFLRKWIPTDITYVSFIGVMHLGCLLAPFTFTWGAFKCFLAMY
FITGCLGITLSYHRQIAHKSFRTPKWLEYALAYCGALAMQGDPLEWASSHRYHHQHCDTP
KDPHTPYEGFWWSHAGWLLDNEATIERVGDRSNAQELAAQPFYRFMEKTYIWHIAASAAV
LFALGGLPWLVWGFCVRTVWVWHITWAVNSVAHCWGSQEFNTGDLSRNNWLIGILAYGEG
WHNNHHAFEFSARHGLRWWQIDMTWMVISVLKFFRLADKVKLPKEAQMERMRFQPTQA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaagacgcgaagcatcacggcgccgggggtgatcgagctcggggacgagaac
aacgacgcggtggtttggaagagactcggacaagaaggcgtcgataaggcggtcgagttg
tggagttcggtgaacagtgaggcggcggcggcggcaaaaggggcgtgggccggcgtgaag
cccgcgcacaaggttttcctttcggatattttggcgagtccgaagcgcaacgcgtttttg
agaaagtggattccgacggatatcacgtacgtcagtttcatcggagtcatgcacctcggg
tgcctgctcgcgccgtttactttcacctggggagcgttcaagtgcttcttggcgatgtat
ttcatcactggttgcctcggtatcacgctgagctatcacaggcagattgcgcacaagtcg
ttccgcacgcccaagtggctcgagtacgcgctcgcgtactgcggtgcgttggccatgcaa
ggtgacccgttggagtgggcgtcgagccaccgttaccaccaccagcactgcgacacgccc
aaagacccgcacacgccgtacgaaggcttctggtggtcgcacgccggatggttgttggat
aacgaggcgaccatcgagcgcgtgggggatcgctcgaacgcccaagagctcgcggcgcag
ccgttctaccgcttcatggagaagacgtacatctggcatatcgccgcgtccgccgctgtg
ttgttcgccctcggcggtttgccgtggctcgtttggggtttctgcgtgcgcaccgtgtgg
gtgtggcacatcacttgggcggtgaactcggtggcgcactgctggggttcgcaagagttc
aacacgggtgatttgtctcgcaacaattggctcataggtatcttggcgtacggtgaaggc
tggcacaacaaccatcacgccttcgaatttagcgctcgccacggattacgttggtggcaa
attgatatgacttggatggtcatcagcgtgttgaagttcttccgcttggcggataaggtg
aaactcccgaaggaggcgcagatggaacgcatgcgtttccagccaacccaagcctaa

DBGET integrated database retrieval system