KEGG   Ostreococcus lucimarinus: OSTLU_51907Help
Entry
OSTLU_51907       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:olu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:olu00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 443 aa AA seqDB search
MAKRSEPKPANAEDNSQTGKIAIVALAALGLAIKSRVARSKADAKPFVTRLPTATNSTPG
ASSSVDKSPSGRALRSPLRPRDSSTRDHAAEGLALIELEARGVAVSVSPFGATIVSLRAA
RRGDADEKDDVVLGFDDCESYDEVEGRPYFGAVCGRVANRIARGEFAVGRRTHTLAKNNG
ENTLHGGTSGWDRKRWTVEDQTRSSVTLSYVSVDGEEGFPANVKMYVVYSVLCVRNCAEV
TTKMTATADAMTPISTVQHTYFNLNGHACGEDCSSHVVEMPNCDRYVPVNEDTLIPTGEG
LRKVDGTAFDLRSPTPMFEKSSEGYDNTFVIAGADATRPTSELPRAAPRLAARVTCEDAG
RVLEVLTDAPGVHLYTGNFLSENMVGKKKERARYRKHGGFCLETGWFPDAVNQHSKIGAS
YPSVMVNRGDTYSHTLTYRLSNI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgatcggaaccgaaacccgcgaacgcggaggacaactcgcagaccggtaaa
atcgccatcgtcgccctcgccgcgctcggtttagcgatcaagtctcgcgtcgcgcgctcg
aaagccgacgccaaaccgttcgtcacgcgtttaccgaccgcgacgaactcgacgcccggc
gcgtcgtcgagcgtcgataagagcccgtccggtcgcgcgttgcgctcgccgttgcgtcct
cgcgactcctcgacgcgtgatcacgcggcggagggtttggcgttgatcgagctcgaggcg
cgcggcgtcgccgtctcggtgtcgccgttcggcgcgacgatcgtctcgctgcgcgcggcg
cggcgcggggacgcggacgagaaggatgacgtcgttctcgggttcgatgattgcgagagt
tacgatgaggtcgagggaaggccgtattttggtgcggtgtgtggacgggtggcgaatcga
atcgcgcgcggggaattcgccgtcggccgaaggacgcacacgctggcgaagaataacggg
gagaatacgctgcacggcgggacttcgggatgggatcgtaagcggtggacggtggaggat
caaacgcgaagtagtgtgacgttgagttacgtgagcgtcgatggtgaagaagggttcccg
gcgaacgtgaagatgtacgtggtgtactccgtcctttgcgtgcgaaattgcgccgaggtg
acgacgaagatgacggcgacggcggatgcgatgacaccaatttccacggtgcagcacacg
tactttaatttgaacggacacgcgtgcggggaggattgctcgtcgcacgtcgtcgagatg
ccgaattgcgaccggtacgtcccggtgaacgaggacacgctgattcccacgggcgaaggt
ttgcgcaaggtggacggcacggcgtttgatttacgttctccgacaccgatgtttgagaaa
tcgagcgaaggctacgacaacacgttcgtcatcgccggcgcagacgcgacgagaccgacg
agcgaactcccgcgcgcggcgccgcgattggcggcgcgcgtcacgtgcgaagacgccgga
cgcgttttagaggttttaacggacgccccgggcgtgcatttatacaccggcaactttctc
tccgagaatatggtcgggaagaagaaggaacgcgcgcgataccgcaagcacggcggattc
tgtctagagacgggctggttccccgacgccgtcaatcagcactcgaaaatcggcgcctcg
tacccgagcgtcatggtcaaccgcggcgacacgtactcgcacacgctaacgtaccgactt
tcgaacatttaa

DBGET integrated database retrieval system