KEGG   Ostreococcus lucimarinus: OSTLU_51907Help
Entry
OSTLU_51907       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
olu  Ostreococcus lucimarinus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OSTLU_51907
   00052 Galactose metabolism
    OSTLU_51907
Enzymes [BR:olu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     OSTLU_51907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 443 aa AA seqDB search
MAKRSEPKPANAEDNSQTGKIAIVALAALGLAIKSRVARSKADAKPFVTRLPTATNSTPG
ASSSVDKSPSGRALRSPLRPRDSSTRDHAAEGLALIELEARGVAVSVSPFGATIVSLRAA
RRGDADEKDDVVLGFDDCESYDEVEGRPYFGAVCGRVANRIARGEFAVGRRTHTLAKNNG
ENTLHGGTSGWDRKRWTVEDQTRSSVTLSYVSVDGEEGFPANVKMYVVYSVLCVRNCAEV
TTKMTATADAMTPISTVQHTYFNLNGHACGEDCSSHVVEMPNCDRYVPVNEDTLIPTGEG
LRKVDGTAFDLRSPTPMFEKSSEGYDNTFVIAGADATRPTSELPRAAPRLAARVTCEDAG
RVLEVLTDAPGVHLYTGNFLSENMVGKKKERARYRKHGGFCLETGWFPDAVNQHSKIGAS
YPSVMVNRGDTYSHTLTYRLSNI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgatcggaaccgaaacccgcgaacgcggaggacaactcgcagaccggtaaa
atcgccatcgtcgccctcgccgcgctcggtttagcgatcaagtctcgcgtcgcgcgctcg
aaagccgacgccaaaccgttcgtcacgcgtttaccgaccgcgacgaactcgacgcccggc
gcgtcgtcgagcgtcgataagagcccgtccggtcgcgcgttgcgctcgccgttgcgtcct
cgcgactcctcgacgcgtgatcacgcggcggagggtttggcgttgatcgagctcgaggcg
cgcggcgtcgccgtctcggtgtcgccgttcggcgcgacgatcgtctcgctgcgcgcggcg
cggcgcggggacgcggacgagaaggatgacgtcgttctcgggttcgatgattgcgagagt
tacgatgaggtcgagggaaggccgtattttggtgcggtgtgtggacgggtggcgaatcga
atcgcgcgcggggaattcgccgtcggccgaaggacgcacacgctggcgaagaataacggg
gagaatacgctgcacggcgggacttcgggatgggatcgtaagcggtggacggtggaggat
caaacgcgaagtagtgtgacgttgagttacgtgagcgtcgatggtgaagaagggttcccg
gcgaacgtgaagatgtacgtggtgtactccgtcctttgcgtgcgaaattgcgccgaggtg
acgacgaagatgacggcgacggcggatgcgatgacaccaatttccacggtgcagcacacg
tactttaatttgaacggacacgcgtgcggggaggattgctcgtcgcacgtcgtcgagatg
ccgaattgcgaccggtacgtcccggtgaacgaggacacgctgattcccacgggcgaaggt
ttgcgcaaggtggacggcacggcgtttgatttacgttctccgacaccgatgtttgagaaa
tcgagcgaaggctacgacaacacgttcgtcatcgccggcgcagacgcgacgagaccgacg
agcgaactcccgcgcgcggcgccgcgattggcggcgcgcgtcacgtgcgaagacgccgga
cgcgttttagaggttttaacggacgccccgggcgtgcatttatacaccggcaactttctc
tccgagaatatggtcgggaagaagaaggaacgcgcgcgataccgcaagcacggcggattc
tgtctagagacgggctggttccccgacgccgtcaatcagcactcgaaaatcggcgcctcg
tacccgagcgtcatggtcaaccgcggcgacacgtactcgcacacgctaacgtaccgactt
tcgaacatttaa

DBGET integrated database retrieval system