KEGG   Ostreococcus lucimarinus: OSTLU_5433Help
Entry
OSTLU_5433        CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K11855  ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     OSTLU_5433
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   OSTLU_5433
Ubiquitin system [BR:olu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    OSTLU_5433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 5004295
NCBI-ProteinID: XP_001420231
JGI: 5433
UniProt: A4S492
Position
11:<3013..>3960
Genome map
AA seq 316 aa AA seqDB search
GAGLANLGNTCFLNSVLQCLTHTPALANFALRGEHKKYKTGGSFNALYEIGEHVARALNS
SGRTIAPTALVKNLRALSKTFRKGRQEDAHELARCLLDAMHKKCVEVVKPKISPNSARAE
TSFVWKVFGGRLRSQVNCKTCGRNSETFDPFLDLSLEVGRAKSVLGAFKMFTHTEVLDGD
NKYRCEGKSANSKSHLTKASKQFTVNQAPNVLALQLKRFAYVPFGRGKLNHFVEYPLELD
ITPYTSDEGLTSRGKAVYDLYGVLVHAGNSSNSGHYYCFVKVATGTWCLMDDDEITSVSE
KVVLKQQAYLLFYARR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ggcgcggggctggccaacctcggaaacacgtgctttctgaattcggtcctccagtgctta
acacatacaccggcgttggcgaacttcgcgctgcgcggagagcacaagaaatataaaacg
ggcggttcattcaacgctttgtatgaaatcggtgagcacgtggctcgggcgttgaactcg
agtgggagaacgattgcgccgacggcgttggtgaagaatttaagagcgctttcaaagacc
tttcgtaaaggtcgacaggaagatgctcacgagttggcgcgttgtttgttagatgcgatg
cataagaagtgtgtcgaagtagttaagccaaagatatcgccgaattcggcgcgtgcggag
acgagctttgtttggaaggtttttggaggtcggctgcgctcacaggtgaattgtaagacg
tgcggtcgcaactcggagacgttcgatccatttcttgacttatccttggaagttggccgg
gcgaaaagtgtattaggtgctttcaagatgttcacgcacactgaagtgctcgacggtgac
aacaagtataggtgcgaaggcaaaagcgcgaattcaaagagtcacttgacgaaggcttcg
aagcagttcacggtgaatcaggcaccaaacgtgctcgcgttacagttgaagaggtttgca
tacgtgcctttcgggagaggaaagctgaatcatttcgttgagtaccctctggagctcgat
atcacgccatacacttcagacgaaggtcttacgtcgagaggaaaggcagtttacgatttg
tacggcgtgctcgtgcacgcgggtaacagctcaaatagcggtcattattactgttttgtc
aaggtggcaacgggaacttggtgcttgatggatgacgatgaaattacctcagtgagtgaa
aaagtggtgctcaagcagcaagcgtatttactcttttatgctcgccgc

DBGET integrated database retrieval system