KEGG   Ostreococcus lucimarinus: OSTLU_5465Help
Entry
OSTLU_5465        CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06634  cyclin H
Organism
olu  Ostreococcus lucimarinus
Pathway
olu03022  Basal transcription factors
olu03420  Nucleotide excision repair
Module
olu_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    OSTLU_5465
  Replication and repair
   03420 Nucleotide excision repair
    OSTLU_5465
Transcription machinery [BR:olu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     OSTLU_5465
DNA repair and recombination proteins [BR:olu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     OSTLU_5465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2 TFIIB RB_B Ku_C
Motif
Other DBs
NCBI-GeneID: 5000779
NCBI-ProteinID: XP_001416639
JGI: 5465
UniProt: A4RUA6
Position
3:<371570..>372337
Genome map
AA seq 256 aa AA seqDB search
LTSEEERLILRYHEHKIQTICAAFVLPRKVKSTAVMLFKRFTLRHGVGAHSLKIIMLTSI
YVACKVEESYISADEFCKGVREDPARVLAAEVTFLSGLKFQLVCYGAARPLDGFLRDVED
GGCKVTGAQLVACRKSALETIDALMLTDVPLVRPPGQIALCALRRAARQAEATDLVEYCE
AVGARATGIVKAPKGALLKGILDEIETHVEDGTEPDEAVVKKIDKKLKLWRAKYVAASKA
TAEDEAKKTERDAKRR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgacgagcgaggaagagcgattgatcctgcggtatcacgaacataagattcagacgata
tgcgcggcgtttgtgctgccgcgaaaggtgaagagcacggcggtgatgttgtttaagagg
ttcacgctgcgacacggcgtcggagcgcacagcctgaagattatcatgttgacgagcata
tacgtcgcgtgtaaggttgaggagagttacatcagcgctgatgagttttgcaaaggggtg
agagaggatccggcgcgagtgctcgcggcggaggtgacgtttttgtcgggattgaagttt
cagctcgtgtgctacggcgccgctcgaccgctcgacgggttcctcagagacgtggaagat
ggagggtgtaaggtcacaggcgcacagcttgtggcgtgccgaaagagcgctttagagacg
atcgatgcgttgatgctcacggatgttcctttagtgcgtcctccgggacaaatcgcactg
tgcgcgcttcgtcgcgctgcgcgccaagccgaggcaacggaccttgtcgagtattgtgaa
gccgtcggtgcgcgcgcgacggggatcgtcaaagcgcccaagggggcgttgttgaagggc
attttagatgagatcgagacgcacgtcgaggacggcactgagcccgacgaggcggtggtg
aagaagatcgacaaaaagctcaaactgtggcgagcaaagtacgtcgcggcgagcaaggcg
acggcggaggacgaagcgaagaagaccgagcgcgacgccaaacgacga

DBGET integrated database retrieval system