KEGG   Ostreococcus lucimarinus: OSTLU_5465Help
Entry
OSTLU_5465        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
olu  Ostreococcus lucimarinus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:olu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    OSTLU_5465
  Replication and repair
   03420 Nucleotide excision repair
    OSTLU_5465
Transcription machinery [BR:olu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     OSTLU_5465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 256 aa AA seqDB search
LTSEEERLILRYHEHKIQTICAAFVLPRKVKSTAVMLFKRFTLRHGVGAHSLKIIMLTSI
YVACKVEESYISADEFCKGVREDPARVLAAEVTFLSGLKFQLVCYGAARPLDGFLRDVED
GGCKVTGAQLVACRKSALETIDALMLTDVPLVRPPGQIALCALRRAARQAEATDLVEYCE
AVGARATGIVKAPKGALLKGILDEIETHVEDGTEPDEAVVKKIDKKLKLWRAKYVAASKA
TAEDEAKKTERDAKRR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgacgagcgaggaagagcgattgatcctgcggtatcacgaacataagattcagacgata
tgcgcggcgtttgtgctgccgcgaaaggtgaagagcacggcggtgatgttgtttaagagg
ttcacgctgcgacacggcgtcggagcgcacagcctgaagattatcatgttgacgagcata
tacgtcgcgtgtaaggttgaggagagttacatcagcgctgatgagttttgcaaaggggtg
agagaggatccggcgcgagtgctcgcggcggaggtgacgtttttgtcgggattgaagttt
cagctcgtgtgctacggcgccgctcgaccgctcgacgggttcctcagagacgtggaagat
ggagggtgtaaggtcacaggcgcacagcttgtggcgtgccgaaagagcgctttagagacg
atcgatgcgttgatgctcacggatgttcctttagtgcgtcctccgggacaaatcgcactg
tgcgcgcttcgtcgcgctgcgcgccaagccgaggcaacggaccttgtcgagtattgtgaa
gccgtcggtgcgcgcgcgacggggatcgtcaaagcgcccaagggggcgttgttgaagggc
attttagatgagatcgagacgcacgtcgaggacggcactgagcccgacgaggcggtggtg
aagaagatcgacaaaaagctcaaactgtggcgagcaaagtacgtcgcggcgagcaaggcg
acggcggaggacgaagcgaagaagaccgagcgcgacgccaaacgacga

DBGET integrated database retrieval system