KEGG   Ostreococcus lucimarinus: OSTLU_5668Help
Entry
OSTLU_5668        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_5668
Enzymes [BR:olu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OSTLU_5668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 249 aa AA seqDB search
VVCTRERGKNGALMNLLAARGARCVELPLVEAVPGEDAATFPDVLKRESWDWVCVTSPEA
AKVFLEAYERAGRPSGVRVAVVGAGTGKVLAKAEPTTFAMDKQFTPSKATAATMAAELPC
DQGSLILYPASKKAATTLQDGLEARGATVVRLNTYSTERVERLSPEDVAAAVRADVVTFG
SPSAVRAWVELCGDALYERLTADARALQPAYVCIGETSAEACANCELPDVFYPELPGIEG
WAETVFLAL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtcgtgtgcacgcgcgagcgcggtaagaacggcgcgctgatgaacctgctcgccgcgaga
ggcgcgcggtgcgtcgagctgccgctcgtggaagccgtcccgggcgaagacgcggcgacg
tttcccgacgtgctgaagcgcgagagctgggattgggtgtgcgtcacgagtccagaggcg
gcgaaggtatttttagaggcgtacgagagggccggtaggccgagcggggtgcgagtggcg
gtcgtcggcgccgggacggggaaggtgctcgcgaaggcggagccgacgacgttcgcgatg
gataaacagttcaccccgagcaaagccacggcggcgacgatggcggccgagttaccgtgc
gatcaggggtcgttgatactgtacccggcgagcaagaaggcggcgacgacgctgcaggat
ggattagaagcgcgcggggcgacggtggtgcgcctgaacacgtactcgaccgagcgcgtc
gagcgactgagccccgaggacgtcgccgccgccgtgcgcgccgacgtcgtcactttcgga
agccccagcgccgttcgcgcctgggtcgagctctgcggcgacgccctgtacgagcgtctc
accgccgacgcgcgcgcgctccagcccgcctacgtgtgcatcggcgaaacctccgccgag
gcgtgcgccaactgcgagctccccgacgtcttctaccccgagctccccggcatcgagggc
tgggccgaaaccgtgttcctagccctg

DBGET integrated database retrieval system