KEGG   Ostreococcus lucimarinus: OSTLU_5668Help
Entry
OSTLU_5668        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:olu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 249 aa AA seqDB search
VVCTRERGKNGALMNLLAARGARCVELPLVEAVPGEDAATFPDVLKRESWDWVCVTSPEA
AKVFLEAYERAGRPSGVRVAVVGAGTGKVLAKAEPTTFAMDKQFTPSKATAATMAAELPC
DQGSLILYPASKKAATTLQDGLEARGATVVRLNTYSTERVERLSPEDVAAAVRADVVTFG
SPSAVRAWVELCGDALYERLTADARALQPAYVCIGETSAEACANCELPDVFYPELPGIEG
WAETVFLAL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtcgtgtgcacgcgcgagcgcggtaagaacggcgcgctgatgaacctgctcgccgcgaga
ggcgcgcggtgcgtcgagctgccgctcgtggaagccgtcccgggcgaagacgcggcgacg
tttcccgacgtgctgaagcgcgagagctgggattgggtgtgcgtcacgagtccagaggcg
gcgaaggtatttttagaggcgtacgagagggccggtaggccgagcggggtgcgagtggcg
gtcgtcggcgccgggacggggaaggtgctcgcgaaggcggagccgacgacgttcgcgatg
gataaacagttcaccccgagcaaagccacggcggcgacgatggcggccgagttaccgtgc
gatcaggggtcgttgatactgtacccggcgagcaagaaggcggcgacgacgctgcaggat
ggattagaagcgcgcggggcgacggtggtgcgcctgaacacgtactcgaccgagcgcgtc
gagcgactgagccccgaggacgtcgccgccgccgtgcgcgccgacgtcgtcactttcgga
agccccagcgccgttcgcgcctgggtcgagctctgcggcgacgccctgtacgagcgtctc
accgccgacgcgcgcgcgctccagcccgcctacgtgtgcatcggcgaaacctccgccgag
gcgtgcgccaactgcgagctccccgacgtcttctaccccgagctccccggcatcgagggc
tgggccgaaaccgtgttcctagccctg

DBGET integrated database retrieval system