KEGG   Ostreococcus lucimarinus: OSTLU_6409Help
Entry
OSTLU_6409        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
olu  Ostreococcus lucimarinus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 334 aa AA seqDB search
TTRAPVGLRGSLNMGNTCFLSSILQTLVSTAPVVEYFLRENHARRAGGCEIDDCVACAFD
EYVSKAYDDARVATSSAPSTASTALVAGELLYAWWVNEPSMAKEQQQDAHEFFLSFLSVA
HANVLGRSIRPRKKRAEDAATCECVFHTAFAGVLRSDIACASCGASTTTREATTGVSLDV
PPATKSSRVSLMECLSNFTAMETIENTSRRVCSACAVVSESHGKQTRFERVPKILNFHFK
RFEGDFKSMRKNDIHVDFPFDLDMSPYHAHDCKETNHDAAYELYSVVQHSGVLEGGHYVA
YVRRDGAWFLCDDAVVREADENEVKSSQAFMLFY
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
acgacgcgcgccccggtcggtctgcgcggcagcctcaacatggggaacacgtgcttcctc
tcgagcatattgcagacgctcgtctcgacggcaccggtggtggaatatttcttgcgcgaa
aaccacgcgcggcgcgcggggggatgcgagatagacgattgcgtggcgtgcgcgttcgac
gagtacgtgagcaaggcgtacgacgacgcgcgggtggcgacgtcgagcgcgccttcgacg
gcttcgacggcgctcgtggcgggcgagttgttgtacgcgtggtgggtgaacgaaccatcg
atggcgaaggagcagcaacaggacgcgcacgaattttttctcagctttttatccgtggcg
cacgcgaacgtgttggggaggtcgatacgaccacgcaagaaacgcgccgaggacgcggcg
acgtgtgaatgcgtctttcacaccgcattcgcgggcgtattgcgatcagatatcgcgtgt
gcgtcgtgcggcgcttcgacgacgacgcgcgaggcgacgacgggcgtttcgctcgacgtg
cctccggcgacgaaatcgtcgcgagtgagcctgatggagtgcttgagcaatttcaccgcc
atggagacgatcgaaaacacgtcgcgtcgagtgtgctcggcgtgcgcggtcgtcagcgaa
tcgcacggcaagcagacccgctttgaacgcgttccgaaaatcttaaattttcacttcaag
cgcttcgagggcgacttcaagtcgatgcgcaagaacgacattcacgtcgacttcccgttc
gacctggacatgtcgccttatcacgcgcatgattgcaaggaaaccaaccacgacgccgcg
tacgagttgtacagcgtcgtccaacacagcggagtcctcgaaggtggacattacgtggcg
tacgtgaggcgagacggtgcctggttcctgtgtgacgacgctgtcgtgcgcgaggccgat
gagaacgaggtgaaatcatcgcaggcgttcatgttgttctat

DBGET integrated database retrieval system