KEGG   Ostreococcus lucimarinus: OSTLU_776Help
Entry
OSTLU_776         CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00860  Porphyrin and chlorophyll metabolism
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OSTLU_776
Enzymes [BR:olu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OSTLU_776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase VWA_2 MCM Sigma54_activat VWA AAA_5 AAA_16 AAA_22 Pox_Ag35 CCDC53 CAP_N AAA tRNA_anti-like FAM176
Motif
Other DBs
NCBI-GeneID: 5003392
NCBI-ProteinID: XP_001419269
JGI: 776
UniProt: A4S0Y4
Position
8:complement(<54892..56853)
Genome map
AA seq 654 aa AA seqDB search
MPLTAIVNHDGVKAALLVAAVDPACSLIVSGRRGTGKSILCRSVKSLLPRPRVMGADIGA
PSFVSVPLGVTEDMVAGTLDINASAKSGLAVFQPGLLALANGGALYIDEINLLDDSILAM
IQSSLAEGIARVEREGLSTTMPCECLALASFNPAESELRSHVVDRFAMICGTDDDEGALA
QTTTRLAAIDAAMAWQDDWRRVVSDSYTEQKALGEHIELAHHVFLPGVQISEANVRRLVK
IAVDCACQGHRAELFAVKVARASAALRHSYEVNDQDVNMAISLSILPRATREPPDDALTP
PPPPPPATQKNEREAEEQQDQEDEEQEEEEEEEEEDQVEEIEPEVQRADESGLDVNSLLN
AFEKAMLRSFAEKKSRGSVSGRTKREKVFDLMRGRYVKPIFPKSGQMRGKIAVDATLRAA
APYQIVRRQRRLKPGEVSPRRVFITKDDVRLKKLSRRSASLTIFVVDASGSMAINRMSVA
KAAVFKLLEVSYTKRDLVALVEFSHDAAVVLLPPTRSTVLVSRRLAVMPCGGGTPLAHGL
SVAARCALNARTSKLKSSVGSVREVILSDGRPTRSLRWSEDPRWRSMEPALTRKALRDEV
LEVSIATRRLGFLKTLVVDTDSAFVSEHFCLDIADALGAAYYALPKLEESAFAA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgacggcgatagtgaaccacgacggcgtcaaagctgcactcctcgtagcggcc
gtcgatcctgcgtgctcattgatcgtcagcggtcgacgtgggaccggcaaatcgatctta
tgtcgcagcgtgaagtcgctgttgccgcgaccgcgcgtgatgggtgccgacattggagcg
ccgagtttcgtcagcgtgccgctcggcgtcaccgaggacatggttgcgggcacgctcgac
atcaatgcgagcgcgaaatctggtttagcggtgtttcagcctggattgctcgctcttgcg
aacggtggggcgctctacatcgatgaaatcaatttgctggacgattccattttggcgatg
attcagtcgagtctcgccgaaggcatcgcgagagtcgaaagggaaggtttgagcactacg
atgccttgcgaatgtctcgcgctcgcgagtttcaatcccgccgagtctgagctacggtcg
cacgtcgtggatcgattcgcgatgatttgtgggaccgacgacgacgaaggcgccctcgcg
cagacgacgacgcgactcgcggcgatcgacgccgcgatggcgtggcaagatgattggcgt
cgcgtcgtcagtgattcatacacagagcaaaaggctttgggagagcacatcgagctcgca
catcacgtctttttacccggggtacaaatatcggaagccaacgtgcggcgattggtcaaa
atagccgtggactgcgcatgccaaggtcatcgagcggagctcttcgccgtgaaagtcgca
cgcgcctcggccgcgcttcggcattcgtacgaggtgaacgatcaagatgtgaatatggcg
atttctttgagcatacttccacgtgcgactcgtgaaccaccagacgatgcgttgacgccg
ccgccgccgccgccgccggcgacgcagaagaacgagcgcgaagcagaagaacaacaagat
caggaagacgaagagcaagaggaggaagaggaggaagaggaggaagatcaagtggaagag
atcgagccagaagtccaaagagccgatgaaagtggtcttgatgtcaattcactgctcaac
gcgtttgaaaaggcaatgttgagaagcttcgcggagaagaaatcacgaggctccgtgagc
ggacggaccaagcgcgaaaaggtgttcgatttaatgcgaggcaggtacgtgaaaccaatt
ttcccgaagagcggacaaatgagaggcaaaatcgccgtcgacgccacgcttcgagcggcg
gcgccgtaccaaatcgttcgtcggcaacggcgcctgaaaccgggcgaagtctcaccgaga
cgcgtgttcatcacgaaggacgacgtgaggctaaagaagctcagtcgacgaagcgcatcg
ctcacgatattcgtcgtcgatgccagcggctcgatggcgatcaatcgtatgtccgtcgcg
aaagccgcagtgttcaagctcctggaggtttcgtacacgaagcgcgatctcgtggcgctc
gtcgaattctcgcacgacgccgccgtcgtgctcctgccacccacgagatcgaccgtgctc
gtgagccgacggctcgccgtgatgccgtgcggcggcggtacccctctcgcccacgggctc
tctgtcgccgctcgctgcgctctgaacgcgcgcacatccaaattgaagtctagcgtcggc
tccgtccgcgaagtgatcttgagcgacggacgcccgacgcgcagcctgcgatggtccgaa
gacccgcgttggcgatccatggagcccgcgttaactcgtaaagccctccgcgacgaggtt
ctagaagtttccatcgccacgcgtcggctcggcttcctcaagacgctcgtcgtcgacacg
gattccgccttcgtcagcgagcatttctgtctcgacatcgccgacgcgctcggcgccgcg
tattacgctctcccaaagctcgaagaatccgcattcgcggcg

DBGET integrated database retrieval system