KEGG   Ostreococcus lucimarinus: OSTLU_776Help
Entry
OSTLU_776         CDS       T01029                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:olu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 654 aa AA seqDB search
MPLTAIVNHDGVKAALLVAAVDPACSLIVSGRRGTGKSILCRSVKSLLPRPRVMGADIGA
PSFVSVPLGVTEDMVAGTLDINASAKSGLAVFQPGLLALANGGALYIDEINLLDDSILAM
IQSSLAEGIARVEREGLSTTMPCECLALASFNPAESELRSHVVDRFAMICGTDDDEGALA
QTTTRLAAIDAAMAWQDDWRRVVSDSYTEQKALGEHIELAHHVFLPGVQISEANVRRLVK
IAVDCACQGHRAELFAVKVARASAALRHSYEVNDQDVNMAISLSILPRATREPPDDALTP
PPPPPPATQKNEREAEEQQDQEDEEQEEEEEEEEEDQVEEIEPEVQRADESGLDVNSLLN
AFEKAMLRSFAEKKSRGSVSGRTKREKVFDLMRGRYVKPIFPKSGQMRGKIAVDATLRAA
APYQIVRRQRRLKPGEVSPRRVFITKDDVRLKKLSRRSASLTIFVVDASGSMAINRMSVA
KAAVFKLLEVSYTKRDLVALVEFSHDAAVVLLPPTRSTVLVSRRLAVMPCGGGTPLAHGL
SVAARCALNARTSKLKSSVGSVREVILSDGRPTRSLRWSEDPRWRSMEPALTRKALRDEV
LEVSIATRRLGFLKTLVVDTDSAFVSEHFCLDIADALGAAYYALPKLEESAFAA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgacggcgatagtgaaccacgacggcgtcaaagctgcactcctcgtagcggcc
gtcgatcctgcgtgctcattgatcgtcagcggtcgacgtgggaccggcaaatcgatctta
tgtcgcagcgtgaagtcgctgttgccgcgaccgcgcgtgatgggtgccgacattggagcg
ccgagtttcgtcagcgtgccgctcggcgtcaccgaggacatggttgcgggcacgctcgac
atcaatgcgagcgcgaaatctggtttagcggtgtttcagcctggattgctcgctcttgcg
aacggtggggcgctctacatcgatgaaatcaatttgctggacgattccattttggcgatg
attcagtcgagtctcgccgaaggcatcgcgagagtcgaaagggaaggtttgagcactacg
atgccttgcgaatgtctcgcgctcgcgagtttcaatcccgccgagtctgagctacggtcg
cacgtcgtggatcgattcgcgatgatttgtgggaccgacgacgacgaaggcgccctcgcg
cagacgacgacgcgactcgcggcgatcgacgccgcgatggcgtggcaagatgattggcgt
cgcgtcgtcagtgattcatacacagagcaaaaggctttgggagagcacatcgagctcgca
catcacgtctttttacccggggtacaaatatcggaagccaacgtgcggcgattggtcaaa
atagccgtggactgcgcatgccaaggtcatcgagcggagctcttcgccgtgaaagtcgca
cgcgcctcggccgcgcttcggcattcgtacgaggtgaacgatcaagatgtgaatatggcg
atttctttgagcatacttccacgtgcgactcgtgaaccaccagacgatgcgttgacgccg
ccgccgccgccgccgccggcgacgcagaagaacgagcgcgaagcagaagaacaacaagat
caggaagacgaagagcaagaggaggaagaggaggaagaggaggaagatcaagtggaagag
atcgagccagaagtccaaagagccgatgaaagtggtcttgatgtcaattcactgctcaac
gcgtttgaaaaggcaatgttgagaagcttcgcggagaagaaatcacgaggctccgtgagc
ggacggaccaagcgcgaaaaggtgttcgatttaatgcgaggcaggtacgtgaaaccaatt
ttcccgaagagcggacaaatgagaggcaaaatcgccgtcgacgccacgcttcgagcggcg
gcgccgtaccaaatcgttcgtcggcaacggcgcctgaaaccgggcgaagtctcaccgaga
cgcgtgttcatcacgaaggacgacgtgaggctaaagaagctcagtcgacgaagcgcatcg
ctcacgatattcgtcgtcgatgccagcggctcgatggcgatcaatcgtatgtccgtcgcg
aaagccgcagtgttcaagctcctggaggtttcgtacacgaagcgcgatctcgtggcgctc
gtcgaattctcgcacgacgccgccgtcgtgctcctgccacccacgagatcgaccgtgctc
gtgagccgacggctcgccgtgatgccgtgcggcggcggtacccctctcgcccacgggctc
tctgtcgccgctcgctgcgctctgaacgcgcgcacatccaaattgaagtctagcgtcggc
tccgtccgcgaagtgatcttgagcgacggacgcccgacgcgcagcctgcgatggtccgaa
gacccgcgttggcgatccatggagcccgcgttaactcgtaaagccctccgcgacgaggtt
ctagaagtttccatcgccacgcgtcggctcggcttcctcaagacgctcgtcgtcgacacg
gattccgccttcgtcagcgagcatttctgtctcgacatcgccgacgcgctcggcgccgcg
tattacgctctcccaaagctcgaagaatccgcattcgcggcg

DBGET integrated database retrieval system