KEGG   Ostreococcus lucimarinus: OSTLU_8287Help
Entry
OSTLU_8287        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
olu  Ostreococcus lucimarinus
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:olu00350]
Metabolism; Biosynthesis of other secondary metabolites; Betalain biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 155 aa AA seqDB search
VEIGTFLGYSAIATAMRFKSARARMLCVEYEARHAEVARWALAYAGLDDRVRVLTAAGSE
AVGDARAFVESVKGVGTTEGADVLFLDHAKERYLPDLKLYEDAGVVRRGTIVVADNVVYP
GAPGYLEYVDSSAGRYDTHLLEAMFEYEQVWKGEE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcgggacgtttttggggtacagcgcgatcgcgacggcgatgcggtttaagagc
gcgagggcgaggatgctgtgcgtcgagtacgaggcgcgacacgcggaggtggcgcgatgg
gcgctcgcgtacgcggggctggacgatcgggtgcgagtgctgacggcggcgggatcggag
gcggtgggggacgcgcgcgcgttcgtggagagcgtgaagggggtcgggacgacggagggc
gcggatgtgttgtttctcgatcacgcgaaggagcggtatttgccggatttgaagttgtac
gaagacgcgggcgtggttcgtcgggggacgatcgtcgtcgcggataacgtcgtgtatccg
ggcgcgccggggtatttagagtacgtcgattcgagcgcgggtcggtacgacacgcattta
ttggaggcgatgtttgagtatgagcaggtgtggaagggcgaagag

DBGET integrated database retrieval system