KEGG   Ostreococcus lucimarinus: OSTLU_8287Help
Entry
OSTLU_8287        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
olu  Ostreococcus lucimarinus
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    OSTLU_8287
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    OSTLU_8287
Enzymes [BR:olu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     OSTLU_8287
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OSTLU_8287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 155 aa AA seqDB search
VEIGTFLGYSAIATAMRFKSARARMLCVEYEARHAEVARWALAYAGLDDRVRVLTAAGSE
AVGDARAFVESVKGVGTTEGADVLFLDHAKERYLPDLKLYEDAGVVRRGTIVVADNVVYP
GAPGYLEYVDSSAGRYDTHLLEAMFEYEQVWKGEE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcgggacgtttttggggtacagcgcgatcgcgacggcgatgcggtttaagagc
gcgagggcgaggatgctgtgcgtcgagtacgaggcgcgacacgcggaggtggcgcgatgg
gcgctcgcgtacgcggggctggacgatcgggtgcgagtgctgacggcggcgggatcggag
gcggtgggggacgcgcgcgcgttcgtggagagcgtgaagggggtcgggacgacggagggc
gcggatgtgttgtttctcgatcacgcgaaggagcggtatttgccggatttgaagttgtac
gaagacgcgggcgtggttcgtcgggggacgatcgtcgtcgcggataacgtcgtgtatccg
ggcgcgccggggtatttagagtacgtcgattcgagcgcgggtcggtacgacacgcattta
ttggaggcgatgtttgagtatgagcaggtgtggaagggcgaagag

  All links  
No link information was found.   
DBGET integrated database retrieval system