KEGG   Ostreococcus lucimarinus: OSTLU_8354Help
Entry
OSTLU_8354        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
olu  Ostreococcus lucimarinus
Brite
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     OSTLU_8354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 145 aa AA seqDB search
MGLTASSLNLTQYDIEDVQQHCGGKFTSREIQALYQRFRALDKKHKGFITEDELMAIPEL
AISPLAPRIVQMFQNQNFKDFVRMISALSSKATREERLRFMFHCYDVDRDGVVSRSDLET
ITRHLVGSSISQEDFDQLISKAFGE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcaccgcgagctcgctcaatctcacgcagtacgacatcgaggacgttcagcaa
cactgcggcggtaaattcacctcgcgcgagatccaagcgctgtatcagcgcttccgcgcg
ctcgacaagaagcacaaaggattcatcacggaggacgaactcatggcgattcccgagctc
gccatctccccgctcgcgccgagaatcgtgcagatgttccaaaaccaaaactttaaagac
tttgtgcgcatgatcagcgctctgagctccaaggcgacgcgagaggagcgattgagattt
atgtttcattgctacgacgtcgatcgagacggcgtcgtgtcgaggagcgacttagaaacc
atcacgagacacctggtcggaagctcgatttcgcaggaagacttcgatcaattgatctct
aaagcgttcggggag

DBGET integrated database retrieval system