KEGG   Ostreococcus lucimarinus: OSTLU_8354Help
Entry
OSTLU_8354        CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
olu  Ostreococcus lucimarinus
Brite
Protein phosphatases and associated proteins [BR:olu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     OSTLU_8354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg DUF2202 Dockerin_1 Ntox4
Motif
Other DBs
NCBI-GeneID: 5006702
NCBI-ProteinID: XP_001422645
JGI: 8354
UniProt: A4SAP5
Position
20:complement(<67177..67611)
Genome map
AA seq 145 aa AA seqDB search
MGLTASSLNLTQYDIEDVQQHCGGKFTSREIQALYQRFRALDKKHKGFITEDELMAIPEL
AISPLAPRIVQMFQNQNFKDFVRMISALSSKATREERLRFMFHCYDVDRDGVVSRSDLET
ITRHLVGSSISQEDFDQLISKAFGE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcaccgcgagctcgctcaatctcacgcagtacgacatcgaggacgttcagcaa
cactgcggcggtaaattcacctcgcgcgagatccaagcgctgtatcagcgcttccgcgcg
ctcgacaagaagcacaaaggattcatcacggaggacgaactcatggcgattcccgagctc
gccatctccccgctcgcgccgagaatcgtgcagatgttccaaaaccaaaactttaaagac
tttgtgcgcatgatcagcgctctgagctccaaggcgacgcgagaggagcgattgagattt
atgtttcattgctacgacgtcgatcgagacggcgtcgtgtcgaggagcgacttagaaacc
atcacgagacacctggtcggaagctcgatttcgcaggaagacttcgatcaattgatctct
aaagcgttcggggag

DBGET integrated database retrieval system