KEGG   Ostreococcus lucimarinus: OSTLU_87099Help
Entry
OSTLU_87099       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     OSTLU_87099
Peptidases [BR:olu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   OSTLU_87099
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OSTLU_87099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 830 aa AA seqDB search
MSARVDDDALAVCVRAAERGRIARVRDDQTVFKDECAFSFDSPLSAHGVYVNAETLFGYS
RKYVALDAARTGCEVYVRVKTTRTLKPTSEGEAKDETPTTLGFGVDGGFASESDKYDVDT
TYALVIAPDFDDVSRALPLEGLPETLREACEKIAQKQGFHDTEETKSWQEIREVSRYALE
LAQEDNGKKIPSDPSKWRCEETGESGNLWVNLSDGHIGSGRRHFDGSGGNGSALRHYEAM
KAQGKHYPLVVKLGTISANGADVYSYSPDEDDMVEDPYLAVHLRHWGINMLSMEKTEKSM
AELQIELNKGFEFDKITEAGSQLESAYGPRLVGLKNMGNTCYLNSVMQVLKQVPAVCDRY
FDKYEIFQSAPEDPVTDFPTQMSKLVNALVSDEYASPEAENAAVAVCPRMFKQLVGKGHP
EFSTGRQQDAVEYFQHLLDVMTRAERAASSRVSAGPPTAAQFTFEIEDKLTCVESGNVRY
STRKDNILSLGIPLDKATNKASVAAFKERELKRQKKEEEDVEEIVRPEVPFSACLEVFGS
TETVEDFYSTALKRKSIASKVARMKTMPNFLAVQLRRYYVGDDWTPKKLDVLVDVPKTIS
LEHLRARGLQPGEVELPEDQDGAAMETSSTPAPARVEPDMAIVSALMSMGFSENGSKRAA
LATNNASTEVSMEWVFAHMEDADFNEPLPDPSELPSVSAPSAVNPESVMMLTSMGFGEDA
AEAALKACAGNLERAADWLFSHADDLQSAIAQVNGATNDVGTDVDSTTLDGAGEYELFGI
ISHMGGNTNCGHYVAHVEIDGKWYIFNDRKVALSRQPPTDLGYLYVFRRR
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgcgcgtcgacgacgatgcgctcgcggtgtgcgtcagagccgccgagcgcggg
cgcatcgcgcgcgtgcgcgacgaccaaaccgtgttcaaagatgagtgcgcgttctcgttc
gactctccgttgagcgcgcacggcgtgtacgtcaacgcggagacgctgttcgggtactcg
cgaaagtatgtggcgctagacgccgcgcgcacggggtgcgaggtgtacgttcgggtgaag
acgacgcggacgttgaaaccgacgagcgagggcgaagcgaaggacgagacgccgacgacg
ctcggattcggtgtcgacggtggattcgcgagtgagagcgataaatacgacgtggatacg
acgtatgcgttagtgatcgctcccgatttcgacgatgtctcgcgcgcgctgcctttggaa
ggattaccggagacgcttcgcgaagcgtgcgagaaaatcgcgcaaaagcaaggcttccac
gacaccgaggagacgaaatcttggcaagagattcgcgaggtgtccaggtacgcgctggag
ctcgcgcaggaggacaacggaaagaagattccgagcgatccctcgaagtggcgttgcgag
gagaccggagagagtggaaacttgtgggtcaacttgagcgacggtcacatcgggagcggg
cgcagacattttgatgggtcgggtggtaacgggagcgcgctgcggcactacgaagcgatg
aaggcgcaaggaaagcactatccgctggtggtgaagctcggtacgatcagtgcgaacggc
gcggatgtgtattcgtactccccagacgaagacgacatggtggaggatccgtacttggcc
gtgcacctgcgacactggggaatcaacatgctgtcaatggagaagacggaaaagagcatg
gctgagttgcaaattgagctcaataaaggttttgagtttgacaaaatcaccgaggccggg
tcgcagttggagtcggcgtacgggccgcgactcgtcggcttgaaaaacatgggcaacacg
tgctacttgaactcggtcatgcaggtgcttaagcaagtgcctgcggtgtgcgatcggtac
tttgacaaatatgaaatctttcagagcgcgccggaagatcccgtgactgatttcccgacg
caaatgtcaaaactcgtgaatgctctcgtctctgatgagtacgcgagtccagaggctgag
aacgcggcggtggcggtgtgcccgcgcatgtttaaacagctcgtcggcaaaggacatcca
gagtttagtactggtcgtcaacaagacgcggtagagtatttccagcacttgttagacgtg
atgactcgcgctgaacgagctgcgagctcgcgagtatcagctggtccaccgactgcggcg
cagtttacgtttgagatcgaggacaagctcacgtgcgtggaaagtgggaacgtgcgctac
tcgacgcgaaaggacaacatcctgtcgctcggtattcctttagacaaggcaacgaacaag
gcatcggttgccgctttcaaagaacgcgagctcaagcgccagaaaaaggaggaggaggac
gtggaagaaatcgtgcgacccgaggtgccgttttctgcgtgccttgaagtcttcggctcg
actgagaccgttgaagacttctacagcactgcgctcaaacgcaaatcgatcgcgtcaaaa
gtggcgcgcatgaagacgatgcccaactttctcgcggtgcagctcaggcgttattacgtt
ggtgacgattggacgccgaaaaagctcgacgtcctcgtcgacgtcccgaagacgatttcg
ctcgagcatcttcgcgcgcgggggctacagcctggggaagtcgaacttcccgaagaccaa
gatggtgccgccatggaaacctcatccacgccagcgccagcgcgcgttgaacccgacatg
gcgatcgtaagcgcgctcatgtcgatgggttttagcgaaaacggaagcaagcgcgccgcg
ctcgcgacgaacaacgcgtctactgaggtgtcgatggaatgggtgttcgcgcacatggaa
gacgcggacttcaacgagccgcttcccgatccatctgagttaccatctgtgagtgctcca
tccgcggtgaatccagaatcggtcatgatgctcacgtccatgggcttcggcgaagacgcc
gcggaggccgcgctcaaggcgtgcgcggggaatctggagcgcgcggcggactggttgttt
tcgcacgcagatgatctccaatcggcgatcgctcaagtgaacggtgccacaaacgatgtg
ggtacggacgtcgacagcaccacgctggacggcgccggcgaatacgagctctttggtatc
atcagccacatgggcgggaacacgaactgcgggcattacgtcgcccacgtggaaatcgac
ggcaagtggtacatctttaacgatcgcaaggtggcgctttcgagacagccgcctaccgac
ctcggttacttgtacgtttttagaagacgatga

DBGET integrated database retrieval system